Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

STAT3, Human (His)

STAT3 is a signal transducer and transcriptional activator that coordinates diverse cellular processes in response to growth factors and cytokines such as interleukin-6 and KITLG/SCF. Upon activation, STAT3 recruits coactivators to target gene promoters, thereby affecting proliferation, differentiation, and immune responses. STAT3 Protein, Human (His) is the recombinant human-derived STAT3 protein, expressed by E. coli , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

STAT3 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/stat3-protein-human-his.html

Purity

98.0

Smiles

MAQWNQLQQLDTRYLEQLHQLYSDSFPMELRQFLAPWIESQDWAYAASKESHATLVFHNLLGEIDQQYSRFLQESNVLYQHNLRRIKQFLQSRYLEKPMEIARIVARCLWEESRLLQTAATAAQQGGQANHPTAAVVTEKQQMLEQHLQDVRKRVQDLEQKMKVVENLQDDFDFN

Molecular Formula

6774 (Gene_ID) P40763-1 (M1-N175) (Accession)

Molecular Weight

20&45-47 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Plakophilin 1 (10B2) Alexa Fluor® 546
sc-33636 AF546 200 µg/mL

Plakophilin 1 (10B2) Alexa Fluor® 546

Sign In for Pricing
View Details
KRT1 (Keratin, Type II Cytoskeletal 1, 67kD Cytokeratin, Cytokeratin-1, CK-1, Hair alpha Protein, Keratin-1, K1, Type-II Keratin Kb1, KRTA) (AP)
MBS6132037-01 0.1 mL

KRT1 (Keratin, Type II Cytoskeletal 1, 67kD Cytokeratin, Cytokeratin-1, CK-1, Hair alpha Protein, Keratin-1, K1, Type-II Keratin Kb1, KRTA) (AP)

Sign In for Pricing
View Details
KRT1 (Keratin, Type II Cytoskeletal 1, 67kD Cytokeratin, Cytokeratin-1, CK-1, Hair alpha Protein, Keratin-1, K1, Type-II Keratin Kb1, KRTA) (AP)
MBS6132037-02 5x 0.1 mL

KRT1 (Keratin, Type II Cytoskeletal 1, 67kD Cytokeratin, Cytokeratin-1, CK-1, Hair alpha Protein, Keratin-1, K1, Type-II Keratin Kb1, KRTA) (AP)

Sign In for Pricing
View Details
Anti-beta Catenin CTNNB1 Antibody Picoband® (monoclonal, 1F6) (iFluor647 Conjugate)
M00004-2-iFluor647 100 µg

Anti-beta Catenin CTNNB1 Antibody Picoband® (monoclonal, 1F6) (iFluor647 Conjugate)

Sign In for Pricing
View Details
Calpastatin (CAST) (NM_001042442) Human Untagged Clone
SC311310 10 µg

Calpastatin (CAST) (NM_001042442) Human Untagged Clone

Sign In for Pricing
View Details
Anti-TF/Transferrin Antibody (R2Y30)
RHC02103 100 μg

Anti-TF/Transferrin Antibody (R2Y30)

Sign In for Pricing
View Details