Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

S100A6, Human (His)

The S100A6 protein is a key calcium sensor that actively promotes cellular calcium signaling and is involved in multiple processes, including actin cytoskeletal reorganization and cell motility. As a homodimer binding two calcium ions, it interacts with TPR-containing proteins, CACYBP, ANXA2, ANXA11, SUGT1, tropomyosin, TP53, PPP5C, and TPPP. S100A6 Protein, Human (His) is the recombinant human-derived S100A6 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

S100A6 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/s100a6-protein-human-his.html

Purity

99.90

Smiles

MACPLDQAIGLLVAIFHKYSGREGDKHTLSKKELKELIQKELTIGSKLQDAEIARLMEDLDRNKDQEVNFQEYVTFLGALALIYNEALKG

Molecular Formula

6277 (Gene_ID) P06703 (M1-G90) (Accession)

Molecular Weight

Approximately 12.0 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

B-[3-[[2-Hydroxy-3-[3-(triethoxysilyl)propoxy]propyl]amino]phenyl]boronic acid
TRC-H971470-500MG 500 mg

B-[3-[[2-Hydroxy-3-[3-(triethoxysilyl)propoxy]propyl]amino]phenyl]boronic acid

Sign In for Pricing
View Details
Sialic Acid Microplate Assay Kit
RDSM169 100 Assays

Sialic Acid Microplate Assay Kit

Sign In for Pricing
View Details
2-(Tritylthio)ethanamine
TRC-T890040-250MG 250 mg

2-(Tritylthio)ethanamine

Sign In for Pricing
View Details
Human ANKRD7 activation kit by CRISPRa
GA111182 1 Kit

Human ANKRD7 activation kit by CRISPRa

Sign In for Pricing
View Details
IMPG1 (NM_001563) Human Recombinant Protein
TP314997M 100 µg

IMPG1 (NM_001563) Human Recombinant Protein

Sign In for Pricing
View Details
Texas Red Conjugated Goat Polyclonal Antibody to Human IgG
TA-2100-2 2 mL

Texas Red Conjugated Goat Polyclonal Antibody to Human IgG

Sign In for Pricing
View Details