Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

S100A6, Human (His)

The S100A6 protein is a key calcium sensor that actively promotes cellular calcium signaling and is involved in multiple processes, including actin cytoskeletal reorganization and cell motility. As a homodimer binding two calcium ions, it interacts with TPR-containing proteins, CACYBP, ANXA2, ANXA11, SUGT1, tropomyosin, TP53, PPP5C, and TPPP. S100A6 Protein, Human (His) is the recombinant human-derived S100A6 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

S100A6 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/s100a6-protein-human-his.html

Purity

99.90

Smiles

MACPLDQAIGLLVAIFHKYSGREGDKHTLSKKELKELIQKELTIGSKLQDAEIARLMEDLDRNKDQEVNFQEYVTFLGALALIYNEALKG

Molecular Formula

6277 (Gene_ID) P06703 (M1-G90) (Accession)

Molecular Weight

Approximately 12.0 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Thrombin Activatable Fibrinolysis Inhibitor (TAFI) ELISA Kit
RDR-TAFI-Ra-01 96 Tests

Rat Thrombin Activatable Fibrinolysis Inhibitor (TAFI) ELISA Kit

Sign In for Pricing
View Details
Rat Thrombin Activatable Fibrinolysis Inhibitor (TAFI) ELISA Kit
RDR-TAFI-Ra-02 48 Tests

Rat Thrombin Activatable Fibrinolysis Inhibitor (TAFI) ELISA Kit

Sign In for Pricing
View Details
Superoxide Dismutase 1 (SOD1) (NM_000454) Human Recombinant Protein
TP720521L 500 µg

Superoxide Dismutase 1 (SOD1) (NM_000454) Human Recombinant Protein

Sign In for Pricing
View Details
KRTAP2-4 (NM_033184) Human Over-expression Lysate
LY403233 100 µg

KRTAP2-4 (NM_033184) Human Over-expression Lysate

Sign In for Pricing
View Details
TLE1 (Synovial Sarcoma Marker) (TLE1/2051), 0.2mg/mL
BNUB2051-100 1x 100 µL

TLE1 (Synovial Sarcoma Marker) (TLE1/2051), 0.2mg/mL

Sign In for Pricing
View Details
Frozen Tissue Sections, Colon: sigmoid
CS639877 5x 5 µm

Frozen Tissue Sections, Colon: sigmoid

Sign In for Pricing
View Details