Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

S100A6, Human (His)

The S100A6 protein is a key calcium sensor that actively promotes cellular calcium signaling and is involved in multiple processes, including actin cytoskeletal reorganization and cell motility. As a homodimer binding two calcium ions, it interacts with TPR-containing proteins, CACYBP, ANXA2, ANXA11, SUGT1, tropomyosin, TP53, PPP5C, and TPPP. S100A6 Protein, Human (His) is the recombinant human-derived S100A6 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

S100A6 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/s100a6-protein-human-his.html

Purity

99.90

Smiles

MACPLDQAIGLLVAIFHKYSGREGDKHTLSKKELKELIQKELTIGSKLQDAEIARLMEDLDRNKDQEVNFQEYVTFLGALALIYNEALKG

Molecular Formula

6277 (Gene_ID) P06703 (M1-G90) (Accession)

Molecular Weight

Approximately 12.0 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue Total RNA, Lung
CR560785 5 µg

Tissue Total RNA, Lung

Sign In for Pricing
View Details
2,4,6-Trichlorophenol
TRC-T774150-50G 50 g

2,4,6-Trichlorophenol

Sign In for Pricing
View Details
Tissue FFPE Sections, Liver
CS702890 5x 5 µm

Tissue FFPE Sections, Liver

Sign In for Pricing
View Details
QuantiChrom™ α-Mannosidase Assay Kit
DAMA-100 100 Tests

QuantiChrom™ α-Mannosidase Assay Kit

Sign In for Pricing
View Details
Human TSPY4 activation kit by CRISPRa
GA118939 1 Kit

Human TSPY4 activation kit by CRISPRa

Sign In for Pricing
View Details
CD71 (DF1513), 0.2mg/mL
BNUB0188-500 1x 500 µL

CD71 (DF1513), 0.2mg/mL

Sign In for Pricing
View Details