Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

S100A6, Human (His)

The S100A6 protein is a key calcium sensor that actively promotes cellular calcium signaling and is involved in multiple processes, including actin cytoskeletal reorganization and cell motility. As a homodimer binding two calcium ions, it interacts with TPR-containing proteins, CACYBP, ANXA2, ANXA11, SUGT1, tropomyosin, TP53, PPP5C, and TPPP. S100A6 Protein, Human (His) is the recombinant human-derived S100A6 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

S100A6 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/s100a6-protein-human-his.html

Purity

99.90

Smiles

MACPLDQAIGLLVAIFHKYSGREGDKHTLSKKELKELIQKELTIGSKLQDAEIARLMEDLDRNKDQEVNFQEYVTFLGALALIYNEALKG

Molecular Formula

6277 (Gene_ID) P06703 (M1-G90) (Accession)

Molecular Weight

Approximately 12.0 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human hsa-miR-4417 miRNA Antagomir
abx886470-01 10 nmol

Human hsa-miR-4417 miRNA Antagomir

Sign In for Pricing
View Details
Human hsa-miR-4417 miRNA Antagomir
abx886470-02 20 nmol

Human hsa-miR-4417 miRNA Antagomir

Sign In for Pricing
View Details
Defa24 (NM_001013053) Rat Tagged Lenti ORF Clone
RR206487L3 10 µg

Defa24 (NM_001013053) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
OOCA00044-25T - Guinea Pig Ifng Primer Pair
OOCA00044-25T 25 Tests

OOCA00044-25T - Guinea Pig Ifng Primer Pair

Sign In for Pricing
View Details
HOXB2 Antibody HRP Conjugated
orb1542007 100 µL

HOXB2 Antibody HRP Conjugated

Sign In for Pricing
View Details
Oct4 (POU5F1) (NM_002701) Human Over-expression Lysate
LS005460 100 µg

Oct4 (POU5F1) (NM_002701) Human Over-expression Lysate

Sign In for Pricing
View Details