Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGF-8a, Human

GF-8a Protein, Human is an isoform of FGF-8, an essential factor during embryonic development, involved in the progression of prostate cancer.

Product Specifications

Product Name Alternative

FGF-8a Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fgf-8a-protein-human.html

Purity

97

Smiles

MQHVREQSLVTDQLSRRLIRTYQLYSRTSGKHVQVLANKRINAMAEDGDPFAKLIVETDTFGSRVRVRGAETGLYICMNKKGKLIAKSNGKGKDCVFTEIVLENNYTALQNAKYEGWYMAFTRKGRPRKGSKTRQHQREVHFMKRLPRGHHTTEQSLRFEFLNYPPFTRSLRGSQRTWAPEPR

Molecular Formula

2253 (Gene_ID) P55075-2 (Q23-R204) (Accession)

Molecular Weight

Approximately 21 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Harpain F, et al. FGF8 induces therapy resistance in neoadjuvantly radiated rectal cancer. J Cancer Res Clin Oncol. 2019 Jan;145 (1) :77-86.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Slc17a2 Antibody - middle region : HRP (ARP33987_P050-HRP)
ARP33987_P050-HRP 100 µL

Slc17a2 Antibody - middle region : HRP (ARP33987_P050-HRP)

Sign In for Pricing
View Details
POLR2A Rabbit Polyclonal Antibody
TA397463S 25 µL

POLR2A Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Polyclonal XBP1 Antibody [PerCP]
NBP1-77681PCP 0.1 mL

Rabbit Polyclonal XBP1 Antibody [PerCP]

Sign In for Pricing
View Details
Human TCIM Pre-designed siRNA Set A
SI016395A 1 Each

Human TCIM Pre-designed siRNA Set A

Sign In for Pricing
View Details
CNOT7 Recombinant Rabbit mAb
BS47497-01 50 µL

CNOT7 Recombinant Rabbit mAb

Sign In for Pricing
View Details
CNOT7 Recombinant Rabbit mAb
BS47497-02 100 µL

CNOT7 Recombinant Rabbit mAb

Sign In for Pricing
View Details