FGF-8a, Human
GF-8a Protein, Human is an isoform of FGF-8, an essential factor during embryonic development, involved in the progression of prostate cancer.
Product Specifications
Product Name Alternative
FGF-8a Protein, Human, Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/fgf-8a-protein-human.html
Purity
97
Smiles
MQHVREQSLVTDQLSRRLIRTYQLYSRTSGKHVQVLANKRINAMAEDGDPFAKLIVETDTFGSRVRVRGAETGLYICMNKKGKLIAKSNGKGKDCVFTEIVLENNYTALQNAKYEGWYMAFTRKGRPRKGSKTRQHQREVHFMKRLPRGHHTTEQSLRFEFLNYPPFTRSLRGSQRTWAPEPR
Molecular Formula
2253 (Gene_ID) P55075-2 (Q23-R204) (Accession)
Molecular Weight
Approximately 21 kDa, based on SDS-PAGE under reducing conditions.
References & Citations
[1]Harpain F, et al. FGF8 induces therapy resistance in neoadjuvantly radiated rectal cancer. J Cancer Res Clin Oncol. 2019 Jan;145 (1) :77-86.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS1128164-01 0.02 mg (E-Coli)
Recombinant Xylella fastidiosa DNA replication and repair protein recF (recF)
Sign In for Pricing
View Details MBS1128164-02 0.02 mg (Yeast)
Recombinant Xylella fastidiosa DNA replication and repair protein recF (recF)
Sign In for Pricing
View Details MBS1128164-03 0.1 mg (E-Coli)
Recombinant Xylella fastidiosa DNA replication and repair protein recF (recF)
Sign In for Pricing
View Details