Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Escherichia coli Multidrug efflux pump subunit AcrA (acrA)

Product Specifications

Product Name Alternative

AcrAB-TolC multidrug efflux pump subunit AcrA; Acridine resistance protein A

Abbreviation

Recombinant E.coli acrA protein

Gene Name

AcrA

UniProt

P0AE06

Expression Region

25-397aa

Organism

Escherichia coli (strain K12)

Target Sequence

CDDKQAQQGGQQMPAVGVVTVKTEPLQITTELPGRTSAYRIAEVRPQVSGIILKRNFKEGSDIEAGVSLYQIDPATYQATYDSAKGDLAKAQAAANIAQLTVNRYQKLLGTQYISKQEYDQALADAQQANAAVTAAKAAVETARINLAYTKVTSPISGRIGKSNVTEGALVQNGQATALATVQQLDPIYVDVTQSSNDFLRLKQELANGTLKQENGKAKVSLITSDGIKFPQDGTLEFSDVTVDQTTGSITLRAIFPNPDHTLLPGMFVRARLEEGLNPNAILVPQQGVTRTPRGDATVLVVGADDKVETRPIVASQAIGDKWLVTEGLKAGDRVVISGLQKVRPGVQVKAQEVTADNNQQAASGAQPEQSKS

Tag

C-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

AcrA-AcrB-AcrZ-TolC is a drug efflux protein complex with broad substrate specificity that uses the proton motive force to export substrates. This subunit may act as an adapter protein that links AcrB and TolC stably together. It is elongated in shape, being long enough to span the periplasm.

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

46.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD74 (BU45), CF594 conjugate, 0.1mg/mL
BNC940189-500 1x 500 µL

CD74 (BU45), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44v9 (Marker of Tumor Metastasis) (rCD44v9/1459), CF405S conjugate, 0.1mg/mL
BNC042345-500 1x 500 µL

CD44v9 (Marker of Tumor Metastasis) (rCD44v9/1459), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 10/13 (DE-K13), CF640R conjugate, 0.1mg/mL
BNC400696-500 1x 500 µL

Cytokeratin 10/13 (DE-K13), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ATG5 (Autophagy Marker) (ATG5/2101), CF640R conjugate, 0.1mg/mL
BNC402101-500 1x 500 µL

ATG5 (Autophagy Marker) (ATG5/2101), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (2755-8), CF594 conjugate, 0.1mg/mL
BNC940091-100 1x 100 µL

Fibronectin (2755-8), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44v9 (Marker of Tumor Metastasis) (CD44v9/2344R), CF594 conjugate, 0.1mg/mL
BNC942344-500 1x 500 µL

CD44v9 (Marker of Tumor Metastasis) (CD44v9/2344R), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details