Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LAMP3/CD208, Rhesus Macaque (HEK293, His)

The LAMP3/CD208 protein is a lysosomal membrane glycoprotein that actively participates in the unfolded protein response (UPR), aiding protein degradation and cell survival during proteasome dysfunction. It is essential for lysosome-autophagosome fusion, where it regulates the autophagy process. LAMP3/CD208 Protein, Rhesus Macaque (HEK293, His) is the recombinant Rhesus Macaque-derived LAMP3/CD208 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

LAMP3/CD208 Protein, Rhesus Macaque (HEK293, His), Rhesus Macaque, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/lamp3-cd208-protein-rhesus-macaque-hek293-his.html

Purity

98.0

Smiles

KAFPKTRDYSQPTAAATGQDIAKPVQQPANQAPHQTLAARLMDGHITFQTAATIKTPTTTPVTTKNTPTTSPIIYTLVTTQATSNNSHTAPPLTKVTVGPSLAPYSLPPTITPPAHTTGTSSSTVNHTTGNATQPSNQTTLPATLSIAPHKSTTGQKPVQPTHAPGTTAAAHNTTRTAAPASTVPGSTLAPQPSSIKTGIYQVLNGSRLCIKAEMGIQLIVQDKESVFSPRRYFNLDPNATQASGNCGTRNSNLLLNFQGGFVNLTFTKDEGSYYISEVGACLTVSDPETIYQGMKHAVVMFQTVVGHSFKCVSEQSLQLSAHLQLKTTNVQLQAFDFEDDHFGNVDECSSDYT

Molecular Formula

574213 (Gene_ID) Q8MJJ2 (K28-T381) (Accession)

Molecular Weight

Approximately 60-95 kDa due to the glycosylation

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gde1 siRNA Oligos set (Mouse)
21411174 3x 5 nmol

Gde1 siRNA Oligos set (Mouse)

Sign In for Pricing
View Details
DBC1 mouse mAb
RA11084-01 50 µL

DBC1 mouse mAb

Sign In for Pricing
View Details
DBC1 mouse mAb
RA11084-02 100 µL

DBC1 mouse mAb

Sign In for Pricing
View Details
PPP3R1 (CNA2, CNB, Calcineurin Subunit B Type 1, Protein Phosphatase 2B Regulatory Subunit 1, Protein Phosphatase 3 Regulatory Subunit B alpha Isoform 1) APC
MBS6138409-01 0.1 mL

PPP3R1 (CNA2, CNB, Calcineurin Subunit B Type 1, Protein Phosphatase 2B Regulatory Subunit 1, Protein Phosphatase 3 Regulatory Subunit B alpha Isoform 1) APC

Sign In for Pricing
View Details
PPP3R1 (CNA2, CNB, Calcineurin Subunit B Type 1, Protein Phosphatase 2B Regulatory Subunit 1, Protein Phosphatase 3 Regulatory Subunit B alpha Isoform 1) APC
MBS6138409-02 5x 0.1 mL

PPP3R1 (CNA2, CNB, Calcineurin Subunit B Type 1, Protein Phosphatase 2B Regulatory Subunit 1, Protein Phosphatase 3 Regulatory Subunit B alpha Isoform 1) APC

Sign In for Pricing
View Details
Rabbit Anti-Human ZNF688 pAb
PA9218-01 50 μL

Rabbit Anti-Human ZNF688 pAb

Sign In for Pricing
View Details