Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TNF RII/TNFRSF1B, Mouse (HEK293, His)

TNFRII (TNFRSF1B) protein has a high ability to bind with tumor necrosis factor-alpha (TNF-α) . TNFRII has pro-apoptotic function. TNFRII recruits TRAF2, induces gene expression and intensively crosstalks with TNF-R1. TNFRII selectively enhances the induction of apoptosis by the death receptor TNFRI. TNF RII/TNFRSF1B Protein, Mouse (HEK293, His) is expressed by HEK293 and has a transmembrane region with 6*His tag at the C-terminus[1].

Product Specifications

Product Name Alternative

TNF RII/TNFRSF1B Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tnfrii-protein-mouse-hek-293-his.html

Purity

97.90

Smiles

VPAQVVLTPYKPEPGYECQISQEYYDRKAQMCCAKCPPGQYVKHFCNKTSDTVCADCEASMYTQVWNQFRTCLSCSSSCTTDQVEIRACTKQQNRVCACEAGRYCALKTHSGSCRQCMRLSKCGPGFGVASSRAPNGNVLCKACAPGTFSDTTSSTDVCRPHRICSILAIPGNASTDAVCAPESPTLSAIPRTLYVSQPEPTRSQPLDQEPGPSQTPSILTSLGSTPIIEQSTKGG

Molecular Formula

21938 (Gene_ID) P25119/NP_035740.2 (V23-G258) (Accession)

Molecular Weight

Approximately 33-50 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

References & Citations

[1]Wajant H, et, al. Tumor necrosis factor signaling. Cell Death Differ. 2003 Jan;10 (1) :45-65.|[2]Fotin-Mleczek M, et, al. Apoptotic crosstalk of TNF receptors: TNF-R2-induces depletion of TRAF2 and IAP proteins and accelerates TNF-R1-dependent activation of caspase-8. J Cell Sci. 2002 Jul 1;115 (Pt 13) :2757-70.|[3]Masli S, et, al. Anti-inflammatory effects of tumour necrosis factor (TNF) -alpha are mediated via TNF-R2 (p75) in tolerogenic transforming growth factor-beta-treated antigen-presenting cells. Immunology. 2009 May;127 (1) :62-72.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD11a (Cris-3), CF640R conjugate, 0.1mg/mL
BNC400151-500 1x 500 µL

CD11a (Cris-3), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD47 (B6H12.2), CF740 conjugate, 0.1mg/mL
BNC740437-100 1x 100 µL

CD47 (B6H12.2), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
GP2 (Glycoprotein 2) / ZAP75 (GP2/1803), CF647 conjugate, 0.1mg/mL
BNC471803-100 1x 100 µL

GP2 (Glycoprotein 2) / ZAP75 (GP2/1803), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD20 / MS4A1 (B-Cell Marker) (rIGEL/773), CF640R conjugate, 0.1mg/mL
BNC401829-100 1x 100 µL

CD20 / MS4A1 (B-Cell Marker) (rIGEL/773), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Plasma Cell Marker (LIV3G11, same as 7B18), CF647 conjugate, 0.1mg/mL
BNC470047-500 1x 500 µL

Plasma Cell Marker (LIV3G11, same as 7B18), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 8 (B22.1), CF640R conjugate, 0.1mg/mL
BNC401219-500 1x 500 µL

Cytokeratin 8 (B22.1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details