Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CNDP1, Mouse (HEK293, His)

The CNDP1 protein is critical in cellular processes and catalyzes the hydrolysis of the Xaa-His dipeptide, with the highest activity against carnosine and anserine. This enzyme specificity highlights the critical role of CNDP1 in regulating the breakdown of specific dipeptides, especially those involving histidine. CNDP1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived CNDP1 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CNDP1 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cndp1-protein-mouse-hek293-his.html

Purity

98.0

Smiles

MFSSAHSGLLEKLFHYIDLHQDEFVQTLKEWVAIESDSVQPVPRLRQKLFQMMALAADKLRNLGAGVESIDLGSQQMPDGQSLPIPPILLAELGSDPEKPTVCFYGHLDVQPAQKDDGWLTDPYTLTEVDGKLYGRGATDNKGPVLAWINAVSTFRALQQDLPVNIKFILEGMEEAGSIALEELVMREKDHFFSSVDYIVISDNLWLSQRKPALTYGTRGNCYFTVEVKCRDQDFHSGTFGGILNEPMADLVALLGSLVDSSGHILIPGIYDQMAPITEGEKTMYKNIDMDLEEYQNINQVEKFLFDTKEELLMHLWRYPSLSIHGIEGAFDEPGTKTVIPGRVLGKFSIRLVPTMSPSVVEKQVTQHLEAVFSKRNSFNKMAVSMVLGLHPWTANVNDTQYLAAQRTIKTVFGVNPDMIRDGSTIPIAKIFQAITQKSVMMLPLGAVDDGEHSQNEKINRWNYIQGSKLFAAFFLELSKQHSGHQMPSSVY

Molecular Formula

338403 (Gene_ID) Q8BUG2 (M1-Y492) (Accession)

Molecular Weight

Approximately 57 kDa.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

TFG, ID (TFG, Protein TFG, TRK-fused gene protein) (MaxLight 750)
MBS6355105-01 0.1 mL

TFG, ID (TFG, Protein TFG, TRK-fused gene protein) (MaxLight 750)

Ask
View Details
TFG, ID (TFG, Protein TFG, TRK-fused gene protein) (MaxLight 750)
MBS6355105-02 5x 0.1 mL

TFG, ID (TFG, Protein TFG, TRK-fused gene protein) (MaxLight 750)

Ask
View Details
RCL1 Peptide
DF4444-BP 1 mg

RCL1 Peptide

Ask
View Details
Tumor Infiltrating Lymphocyte (TIL) PathPlex Panel (CD3E, CD8 alpha, CD20)
MBS3907024-01 1 Panel

Tumor Infiltrating Lymphocyte (TIL) PathPlex Panel (CD3E, CD8 alpha, CD20)

Ask
View Details
Tumor Infiltrating Lymphocyte (TIL) PathPlex Panel (CD3E, CD8 alpha, CD20)
MBS3907024-02 5x 1 Panel

Tumor Infiltrating Lymphocyte (TIL) PathPlex Panel (CD3E, CD8 alpha, CD20)

Ask
View Details
Opioid Receptor, delta (DOR1, Opoid Receptor, Opioid Receptor Delta, OR-1, DOR 1, DOR-1) (HRP)
301435-HRP 100 µL

Opioid Receptor, delta (DOR1, Opoid Receptor, Opioid Receptor Delta, OR-1, DOR 1, DOR-1) (HRP)

Ask
View Details