Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CNDP1, Mouse (HEK293, His)

The CNDP1 protein is critical in cellular processes and catalyzes the hydrolysis of the Xaa-His dipeptide, with the highest activity against carnosine and anserine. This enzyme specificity highlights the critical role of CNDP1 in regulating the breakdown of specific dipeptides, especially those involving histidine. CNDP1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived CNDP1 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CNDP1 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cndp1-protein-mouse-hek293-his.html

Purity

98.0

Smiles

MFSSAHSGLLEKLFHYIDLHQDEFVQTLKEWVAIESDSVQPVPRLRQKLFQMMALAADKLRNLGAGVESIDLGSQQMPDGQSLPIPPILLAELGSDPEKPTVCFYGHLDVQPAQKDDGWLTDPYTLTEVDGKLYGRGATDNKGPVLAWINAVSTFRALQQDLPVNIKFILEGMEEAGSIALEELVMREKDHFFSSVDYIVISDNLWLSQRKPALTYGTRGNCYFTVEVKCRDQDFHSGTFGGILNEPMADLVALLGSLVDSSGHILIPGIYDQMAPITEGEKTMYKNIDMDLEEYQNINQVEKFLFDTKEELLMHLWRYPSLSIHGIEGAFDEPGTKTVIPGRVLGKFSIRLVPTMSPSVVEKQVTQHLEAVFSKRNSFNKMAVSMVLGLHPWTANVNDTQYLAAQRTIKTVFGVNPDMIRDGSTIPIAKIFQAITQKSVMMLPLGAVDDGEHSQNEKINRWNYIQGSKLFAAFFLELSKQHSGHQMPSSVY

Molecular Formula

338403 (Gene_ID) Q8BUG2 (M1-Y492) (Accession)

Molecular Weight

Approximately 57 kDa.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

CTLA4 Mouse Monoclonal Antibody [Clone ID: OTI3D2]
CF813248 100 µg

CTLA4 Mouse Monoclonal Antibody [Clone ID: OTI3D2]

Ask
View Details
LILRB1 (Leukocyte Immunoglobulin-like Receptor Subfamily B Member 1, LIR-1, Leukocyte Immunoglobulin-like Receptor 1, CD85 Antigen-like Family Member J, Immunoglobulin-like Transcript 2, ILT-2, Monocyte/Macrophage Immunoglobulin-like Receptor 7, MIR-7, CD85j, ILT2, LIR1, MIR7, FLJ37515) (APC)
129094-APC 100 µL

LILRB1 (Leukocyte Immunoglobulin-like Receptor Subfamily B Member 1, LIR-1, Leukocyte Immunoglobulin-like Receptor 1, CD85 Antigen-like Family Member J, Immunoglobulin-like Transcript 2, ILT-2, Monocyte/Macrophage Immunoglobulin-like Receptor 7, MIR-7, CD85j, ILT2, LIR1, MIR7, FLJ37515) (APC)

Ask
View Details
eIF3L Antibody
C11925-01 50 μL

eIF3L Antibody

Ask
View Details
eIF3L Antibody
C11925-02 100 µL

eIF3L Antibody

Ask
View Details
ZNF398 (Zinc Finger Protein 398, KIAA1339, ZER6, Zinc Finger DNA-binding Protein p52/p71) (MaxLight 490)
135724-ML490 100 µL

ZNF398 (Zinc Finger Protein 398, KIAA1339, ZER6, Zinc Finger DNA-binding Protein p52/p71) (MaxLight 490)

Ask
View Details