Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CNDP1, Mouse (HEK293, His)

The CNDP1 protein is critical in cellular processes and catalyzes the hydrolysis of the Xaa-His dipeptide, with the highest activity against carnosine and anserine. This enzyme specificity highlights the critical role of CNDP1 in regulating the breakdown of specific dipeptides, especially those involving histidine. CNDP1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived CNDP1 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CNDP1 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cndp1-protein-mouse-hek293-his.html

Purity

98.0

Smiles

MFSSAHSGLLEKLFHYIDLHQDEFVQTLKEWVAIESDSVQPVPRLRQKLFQMMALAADKLRNLGAGVESIDLGSQQMPDGQSLPIPPILLAELGSDPEKPTVCFYGHLDVQPAQKDDGWLTDPYTLTEVDGKLYGRGATDNKGPVLAWINAVSTFRALQQDLPVNIKFILEGMEEAGSIALEELVMREKDHFFSSVDYIVISDNLWLSQRKPALTYGTRGNCYFTVEVKCRDQDFHSGTFGGILNEPMADLVALLGSLVDSSGHILIPGIYDQMAPITEGEKTMYKNIDMDLEEYQNINQVEKFLFDTKEELLMHLWRYPSLSIHGIEGAFDEPGTKTVIPGRVLGKFSIRLVPTMSPSVVEKQVTQHLEAVFSKRNSFNKMAVSMVLGLHPWTANVNDTQYLAAQRTIKTVFGVNPDMIRDGSTIPIAKIFQAITQKSVMMLPLGAVDDGEHSQNEKINRWNYIQGSKLFAAFFLELSKQHSGHQMPSSVY

Molecular Formula

338403 (Gene_ID) Q8BUG2 (M1-Y492) (Accession)

Molecular Weight

Approximately 57 kDa.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Human paramyxovirus parotitis IgM ELISA Kit
SL1338Hu-01 48 Tests

Human paramyxovirus parotitis IgM ELISA Kit

Ask
View Details
Human paramyxovirus parotitis IgM ELISA Kit
SL1338Hu-02 96 Tests

Human paramyxovirus parotitis IgM ELISA Kit

Ask
View Details
Acetyl Lysine Antibody Mouse Monoclonal
AAC01-L 2x 100 µL

Acetyl Lysine Antibody Mouse Monoclonal

Ask
View Details
BRCC2 (BLID, BH3-like Motif-containing Cell Death Inducer, Breast Cancer Cell Protein 2, MGC163233, MGC163235) (HRP)
123991-HRP 100 µL

BRCC2 (BLID, BH3-like Motif-containing Cell Death Inducer, Breast Cancer Cell Protein 2, MGC163233, MGC163235) (HRP)

Ask
View Details