Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CNDP1, Mouse (HEK293, His)

The CNDP1 protein is critical in cellular processes and catalyzes the hydrolysis of the Xaa-His dipeptide, with the highest activity against carnosine and anserine. This enzyme specificity highlights the critical role of CNDP1 in regulating the breakdown of specific dipeptides, especially those involving histidine. CNDP1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived CNDP1 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CNDP1 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cndp1-protein-mouse-hek293-his.html

Purity

98.0

Smiles

MFSSAHSGLLEKLFHYIDLHQDEFVQTLKEWVAIESDSVQPVPRLRQKLFQMMALAADKLRNLGAGVESIDLGSQQMPDGQSLPIPPILLAELGSDPEKPTVCFYGHLDVQPAQKDDGWLTDPYTLTEVDGKLYGRGATDNKGPVLAWINAVSTFRALQQDLPVNIKFILEGMEEAGSIALEELVMREKDHFFSSVDYIVISDNLWLSQRKPALTYGTRGNCYFTVEVKCRDQDFHSGTFGGILNEPMADLVALLGSLVDSSGHILIPGIYDQMAPITEGEKTMYKNIDMDLEEYQNINQVEKFLFDTKEELLMHLWRYPSLSIHGIEGAFDEPGTKTVIPGRVLGKFSIRLVPTMSPSVVEKQVTQHLEAVFSKRNSFNKMAVSMVLGLHPWTANVNDTQYLAAQRTIKTVFGVNPDMIRDGSTIPIAKIFQAITQKSVMMLPLGAVDDGEHSQNEKINRWNYIQGSKLFAAFFLELSKQHSGHQMPSSVY

Molecular Formula

338403 (Gene_ID) Q8BUG2 (M1-Y492) (Accession)

Molecular Weight

Approximately 57 kDa.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tyrosinase (T311), CF647 conjugate, 0.1mg/mL
BNC470012-100 1x 100 µL

Tyrosinase (T311), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD81 / TAPA-1 (1.3.3.22), CF594 conjugate, 0.1mg/mL
BNC940391-500 1x 500 µL

CD81 / TAPA-1 (1.3.3.22), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD81 / TAPA-1 (1.3.3.22), CF405M conjugate, 0.1mg/mL
BNC050391-500 1x 500 µL

CD81 / TAPA-1 (1.3.3.22), CF405M conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (VU-1D9), CF568 conjugate, 0.1mg/mL
BNC680017-500 1x 500 µL

Ep-CAM / CD326 (VU-1D9), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
GAD1 / GAD67 (GABAergic Neuronal Marker) (GAD1/2563), CF640R conjugate, 0.1mg/mL
BNC402563-100 1x 100 µL

GAD1 / GAD67 (GABAergic Neuronal Marker) (GAD1/2563), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP60 (HSPD1/780), CF594 conjugate, 0.1mg/mL
BNC940780-100 1x 100 µL

HSP60 (HSPD1/780), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details