Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Bromodomain-containing protein 4 (BRD4), partial

Product Specifications

Product Name Alternative

Protein HUNK1

Abbreviation

Recombinant Human BRD4 protein, partial

Gene Name

BRD4

UniProt

O60885

Expression Region

342-460aa

Organism

Homo sapiens (Human)

Target Sequence

PAPEKSSKVSEQLKCCSGILKEMFAKKHAAYAWPFYKPVDVEALGLHDYCDIIKHPMDMSTIKSKLEAREYRDAQEFGADVRLMFSNCYKYNPPDHEVVAMARKLQDVFEMRFAKMPDE

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

Yeast

Field of Research

Others

Relevance

Chromatin reader protein that recognizes and binds acetylated histones and plays a key role in transmission of epigenetic memory across cell divisions and transcription regulation. Remains associated with acetylated chromatin throughout the entire cell cycle and provides epigenetic memory for postmitotic G1 gene transcription by preserving acetylated chromatin status and maintaining high-order chromatin structure.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

15.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Prostate
CS505989 5x 5 µm

Frozen Tissue Sections, Prostate

Sign In for Pricing
View Details
IGF1 Mouse Monoclonal Antibody [Clone ID: OTI3A5]
CF805728 100 µg

IGF1 Mouse Monoclonal Antibody [Clone ID: OTI3A5]

Sign In for Pricing
View Details
Phosphoric Acid Tripropyl Ester-d21
TRC-P359397-25MG 25 mg

Phosphoric Acid Tripropyl Ester-d21

Sign In for Pricing
View Details
FITC Anti-Human CD57 Antibody[HNK-1]
E-AB-F1067C-01 20 Tests

FITC Anti-Human CD57 Antibody[HNK-1]

Sign In for Pricing
View Details
FITC Anti-Human CD57 Antibody[HNK-1]
E-AB-F1067C-02 100 Tests

FITC Anti-Human CD57 Antibody[HNK-1]

Sign In for Pricing
View Details
FITC Anti-Human CD57 Antibody[HNK-1]
E-AB-F1067C-03 2x 100 Tests

FITC Anti-Human CD57 Antibody[HNK-1]

Sign In for Pricing
View Details