Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Complement C4-B (C4b), partial

Product Specifications

Abbreviation

Recombinant Mouse C4b protein, partial

Gene Name

C4b

UniProt

P01029

Expression Region

1448-1738aa

Organism

Mus musculus (Mouse)

Target Sequence

EAPKVVEEQESRVQYTVCIWRNGKLGLSGMAIADITLLSGFHALRADLEKLTSLSDRYVSHFETDGPHVLLYFDSVPTTRECVGFGASQEVVVGLVQPSSAVLYDYYSPDHKCSVFYAAPTKSQLLATLCSGDVCQCAEGKCPRLLRSLERRVEDKDGYRMRFACYYPRVEYGFTVKVLREDGRAAFRLFESKITQVLHFRKDTMASIGQTRNFLSRASCRLRLEPNKEYLIMGMDGETSDNKGDPQYLLDSNTWIEEMPSEQMCKSTRHRAACFQLKDFLMEFSSRGCQV

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Immunology

Relevance

Non-enzymatic component of C3 and C5 convertases and thus essential for the propagation of the classical complement pathway. Covalently binds to immunoglobulins and immune complexes and enhances the solubilization of immune aggregates and the clearance of IC through CR1 on erythrocytes. Catalyzes the transacylation of the thioester carbonyl group to form ester bonds with carbohydrate antigens.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

40.5 kDa

References & Citations

"Enhanced analysis of the mouse plasma proteome using cysteine-containing tryptic glycopeptides." Bernhard O.K., Kapp E.A., Simpson R.J. J. Proteome Res. 6:987-995 (2007)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Methyl 1-methylindazole-4-carboxylate
284666-01 50 mg

Methyl 1-methylindazole-4-carboxylate

Sign In for Pricing
View Details
Methyl 1-methylindazole-4-carboxylate
284666-02 100 mg

Methyl 1-methylindazole-4-carboxylate

Sign In for Pricing
View Details
Methyl 1-methylindazole-4-carboxylate
284666-03 250 mg

Methyl 1-methylindazole-4-carboxylate

Sign In for Pricing
View Details
Methyl 1-methylindazole-4-carboxylate
284666-04 500 mg

Methyl 1-methylindazole-4-carboxylate

Sign In for Pricing
View Details
Methyl 1-methylindazole-4-carboxylate
284666-05 1 g

Methyl 1-methylindazole-4-carboxylate

Sign In for Pricing
View Details
Recombinant Kluyveromyces lactis Altered inheritance of mitochondria protein 43, mitochondrial (AIM43)
orb2932058-01 20 µg

Recombinant Kluyveromyces lactis Altered inheritance of mitochondria protein 43, mitochondrial (AIM43)

Sign In for Pricing
View Details