Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Von Hippel-Lindau disease tumor suppressor (VHL), Biotinylated

Product Specifications

Product Name Alternative

Protein G7 pVHL

Abbreviation

Recombinant Human VHL protein, Biotinylated

Gene Name

VHL

UniProt

P40337

Expression Region

1-213aa

Organism

Homo sapiens (Human)

Target Sequence

MPRRAENWDEAEVGAEEAGVEEYGPEEDGGEESGAEESGPEESGPEELGAEEEMEAGRPRPVLRSVNSREPSQVIFCNRSPRVVLPVWLNFDGEPQPYPTLPPGTGRRIHSYRGHLWLFRDAGTHDGLLVNQTELFVPSLNVDGQPIFANITLPVYTLKERCLQVVRSLVKPENYRRLDIVRSLYEDLEDHPNVQKDLERLTQERIAHQRMGD

Tag

N-terminal MBP-tagged and C-terminal 6xHis-Avi-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Cancer

Relevance

Involved in the ubiquitination and subsequent proteasomal degradation via the von Hippel-Lindau ubiquitination complex. Seems to act as a target recruitment subunit in the E3 ubiquitin ligase complex and recruits hydroxylated hypoxia-inducible factor (HIF) under normoxic conditions. Involved in transcriptional repression through interaction with HIF1A, HIF1AN and histone deacetylases. Ubiquitinates, in an oxygen-responsive manner, ADRB2.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

71.9 kDa

References & Citations

"The von Hippel-Lindau tumor-suppressor gene product forms a stable complex with human CUL-2, a member of the Cdc53 family of proteins." Pause A., Lee S., Worrel R., Chen D.Y.T., Burgess W.H., Linehan W.M., Klausner R.D. Proc. Natl. Acad. Sci. U.S.A. 94:2156-2161 (1997)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal GSAP Antibody [mFluor Violet 610 SE]
NBP2-81894MFV610 0.1 mL

Rabbit Polyclonal GSAP Antibody [mFluor Violet 610 SE]

Sign In for Pricing
View Details
CHFR Recombinant Protein (Mouse)
RP123896 100 µg

CHFR Recombinant Protein (Mouse)

Sign In for Pricing
View Details
Recombinant Rhodopseudomonas palustris UPF0317 protein RPC_1666 (RPC_1666)
MBS1467415-01 0.02 mg (E-Coli)

Recombinant Rhodopseudomonas palustris UPF0317 protein RPC_1666 (RPC_1666)

Sign In for Pricing
View Details
Recombinant Rhodopseudomonas palustris UPF0317 protein RPC_1666 (RPC_1666)
MBS1467415-02 0.02 mg (Yeast)

Recombinant Rhodopseudomonas palustris UPF0317 protein RPC_1666 (RPC_1666)

Sign In for Pricing
View Details
Recombinant Rhodopseudomonas palustris UPF0317 protein RPC_1666 (RPC_1666)
MBS1467415-03 0.1 mg (E-Coli)

Recombinant Rhodopseudomonas palustris UPF0317 protein RPC_1666 (RPC_1666)

Sign In for Pricing
View Details
Recombinant Rhodopseudomonas palustris UPF0317 protein RPC_1666 (RPC_1666)
MBS1467415-04 0.1 mg (Yeast)

Recombinant Rhodopseudomonas palustris UPF0317 protein RPC_1666 (RPC_1666)

Sign In for Pricing
View Details