Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MDH1, Rat (His)

MDH1 Protein, an enzyme, is involved in the citric acid cycle and the conversion of malate to oxaloacetate.Dysregulation of MDH1 Protein has been associated with metabolic disorders and cancer.Targeting MDH1 Protein may provide potential therapeutic interventions by modulating energy metabolism, inhibiting tumor growth, and potentially treating these conditions.MDH1 Protein, Rat (His) is the recombinant rat-derived MDH1 protein, expressed by E.coli , with C-His labeled tag.

Product Specifications

Product Name Alternative

MDH1 Protein, Rat (His), Rat, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mdh1-protein-rat-his.html

Purity

98.0

Smiles

MSEPIRVLVTGAAGQIAYSLLYSIGNGSVFGKDQPIILVLLDITPMMGVLDGVLMELQDCALPLLQDVIATDKEEVAFKDLDVAVLVGSMPRREGMERKDLLKANVKIFKSQGAALEKYAKKSVKVIVVGNPANTNCLTASKSAPSIPKENFSCLTRLDHNRAKSQIALKLGVTADDVKNVIIWGNHSSTQYPDVNHAKVKLQGKEVGVYEALKDDSWLKGEFITTVQQRGAAVIKARKLSSAMSAAKAISDHIRDIWFGTPEGEFVSMGVISDGNSYGVPDDLLYSFPVVIKNKTWKFVEGLPINDFSREKMDLTAKELTEEKETAFEFLSSA

Molecular Formula

24551 (Gene_ID) O88989 (M1-A334) (Accession)

Molecular Weight

Approximately 39 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TEPP Lentiviral Activation Particles (h2)
sc-415690-LAC-2 200 µL

TEPP Lentiviral Activation Particles (h2)

Sign In for Pricing
View Details
Phospho-KIT (Tyr936) Antibody
CSB-PA437024 100 µL

Phospho-KIT (Tyr936) Antibody

Sign In for Pricing
View Details
Recombinant Candida albicans Imidazoleglycerol-phosphate dehydratase (HIS3)
MBS1116882-01 0.02 mg (E-Coli)

Recombinant Candida albicans Imidazoleglycerol-phosphate dehydratase (HIS3)

Sign In for Pricing
View Details
Recombinant Candida albicans Imidazoleglycerol-phosphate dehydratase (HIS3)
MBS1116882-02 0.1 mg (E-Coli)

Recombinant Candida albicans Imidazoleglycerol-phosphate dehydratase (HIS3)

Sign In for Pricing
View Details
Recombinant Candida albicans Imidazoleglycerol-phosphate dehydratase (HIS3)
MBS1116882-03 0.02 mg (Yeast)

Recombinant Candida albicans Imidazoleglycerol-phosphate dehydratase (HIS3)

Sign In for Pricing
View Details
Recombinant Candida albicans Imidazoleglycerol-phosphate dehydratase (HIS3)
MBS1116882-04 0.1 mg (Yeast)

Recombinant Candida albicans Imidazoleglycerol-phosphate dehydratase (HIS3)

Sign In for Pricing
View Details