Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD8 alpha, Human (HEK293, His)

CD8 alpha Protein is expressed on the surface of cytotoxic T cells. It plays a crucial role in immune responses by binding to major histocompatibility complex class I molecules on target cells, enhancing T cell activation and cytotoxicity. CD8 alpha Protein is also involved in immune regulation and tolerance. Understanding its functions can aid in developing immunotherapies and vaccines. CD8 alpha Protein, Human (HEK293, His) is the recombinant human-derived CD8 alpha protein, expressed by HEK293 , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

CD8 alpha Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd8a-protein-human-hek-293-his.html

Purity

95.00

Smiles

SQFRVSPLDRTWNLGETVELKCQVLLSNPTSGCSWLFQPRGAAASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGYYFCSALSNSIMYFSHFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACD

Molecular Formula

925 (Gene_ID) P01732 (S22-D182) (Accession)

Molecular Weight

Approximately 28 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Smarcd2 Mouse Gene Knockout Kit (CRISPR)
KN516291 1 Kit

Smarcd2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant Mouse Interleukin-6/IL-6 Protein
PKSM041097-01 20 µg

Recombinant Mouse Interleukin-6/IL-6 Protein

Sign In for Pricing
View Details
Recombinant Mouse Interleukin-6/IL-6 Protein
PKSM041097-02 100 µg

Recombinant Mouse Interleukin-6/IL-6 Protein

Sign In for Pricing
View Details
WDR76 (C-term) Rabbit Polyclonal Antibody
AP54554PU-N 400 µL

WDR76 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CDC25B Rabbit Monoclonal Antibody
TA422811 100 µL

CDC25B Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant Human CD23 Protein (Fc Tag)
PDMH100190-01 20 µg

Recombinant Human CD23 Protein (Fc Tag)

Sign In for Pricing
View Details