Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD8 alpha, Human (HEK293, His)

CD8 alpha Protein is expressed on the surface of cytotoxic T cells. It plays a crucial role in immune responses by binding to major histocompatibility complex class I molecules on target cells, enhancing T cell activation and cytotoxicity. CD8 alpha Protein is also involved in immune regulation and tolerance. Understanding its functions can aid in developing immunotherapies and vaccines. CD8 alpha Protein, Human (HEK293, His) is the recombinant human-derived CD8 alpha protein, expressed by HEK293 , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

CD8 alpha Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd8a-protein-human-hek-293-his.html

Purity

95.00

Smiles

SQFRVSPLDRTWNLGETVELKCQVLLSNPTSGCSWLFQPRGAAASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGYYFCSALSNSIMYFSHFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACD

Molecular Formula

925 (Gene_ID) P01732 (S22-D182) (Accession)

Molecular Weight

Approximately 28 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Syntaxin 18 (Syntaxin-18, STX18, Cell Growth-inhibiting Gene 9 Protein, GIG9, Ufe1) (PE)
134033-PE 100 µL

Syntaxin 18 (Syntaxin-18, STX18, Cell Growth-inhibiting Gene 9 Protein, GIG9, Ufe1) (PE)

Ask
View Details
Polyclonal Antibody to R-Spondin 3 (RSPO3)
MBS2026604-01 0.1 mL

Polyclonal Antibody to R-Spondin 3 (RSPO3)

Ask
View Details
Polyclonal Antibody to R-Spondin 3 (RSPO3)
MBS2026604-02 0.2 mL

Polyclonal Antibody to R-Spondin 3 (RSPO3)

Ask
View Details
Polyclonal Antibody to R-Spondin 3 (RSPO3)
MBS2026604-03 0.5 mL

Polyclonal Antibody to R-Spondin 3 (RSPO3)

Ask
View Details
Polyclonal Antibody to R-Spondin 3 (RSPO3)
MBS2026604-04 1 mL

Polyclonal Antibody to R-Spondin 3 (RSPO3)

Ask
View Details
Polyclonal Antibody to R-Spondin 3 (RSPO3)
MBS2026604-05 5 mL

Polyclonal Antibody to R-Spondin 3 (RSPO3)

Ask
View Details