Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD8 alpha, Human (HEK293, His)

CD8 alpha Protein is expressed on the surface of cytotoxic T cells. It plays a crucial role in immune responses by binding to major histocompatibility complex class I molecules on target cells, enhancing T cell activation and cytotoxicity. CD8 alpha Protein is also involved in immune regulation and tolerance. Understanding its functions can aid in developing immunotherapies and vaccines. CD8 alpha Protein, Human (HEK293, His) is the recombinant human-derived CD8 alpha protein, expressed by HEK293 , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

CD8 alpha Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd8a-protein-human-hek-293-his.html

Purity

95.00

Smiles

SQFRVSPLDRTWNLGETVELKCQVLLSNPTSGCSWLFQPRGAAASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGYYFCSALSNSIMYFSHFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACD

Molecular Formula

925 (Gene_ID) P01732 (S22-D182) (Accession)

Molecular Weight

Approximately 28 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DIABLO
E8ET1610-74 100 µL

DIABLO

Sign In for Pricing
View Details
CD50 Rabbit Polyclonal Antibody
E53P02583 100 µL

CD50 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Mouse Hivep3 qPCR Primer Pair
QM16014S 200 Tests

Mouse Hivep3 qPCR Primer Pair

Sign In for Pricing
View Details
GART (Trifunctional Purine Biosynthetic Protein Adenosine-3, PGFT, PRGS, MGC47764) (FITC)
127171-FITC 100 µL

GART (Trifunctional Purine Biosynthetic Protein Adenosine-3, PGFT, PRGS, MGC47764) (FITC)

Sign In for Pricing
View Details
Rat Airway FibrOut™1: Fibroblast Inhibitory System (for 500 mL medium)
7-15187 1 Kit

Rat Airway FibrOut™1: Fibroblast Inhibitory System (for 500 mL medium)

Sign In for Pricing
View Details
TRAPPC2P1 sgRNA CRISPR Lentivector (Human) (Target 2)
K2440803 1.0 µg DNA

TRAPPC2P1 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details