Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD8 alpha, Human (HEK293, His)

CD8 alpha Protein is expressed on the surface of cytotoxic T cells. It plays a crucial role in immune responses by binding to major histocompatibility complex class I molecules on target cells, enhancing T cell activation and cytotoxicity. CD8 alpha Protein is also involved in immune regulation and tolerance. Understanding its functions can aid in developing immunotherapies and vaccines. CD8 alpha Protein, Human (HEK293, His) is the recombinant human-derived CD8 alpha protein, expressed by HEK293 , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

CD8 alpha Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd8a-protein-human-hek-293-his.html

Purity

95.00

Smiles

SQFRVSPLDRTWNLGETVELKCQVLLSNPTSGCSWLFQPRGAAASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGYYFCSALSNSIMYFSHFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACD

Molecular Formula

925 (Gene_ID) P01732 (S22-D182) (Accession)

Molecular Weight

Approximately 28 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human NBL1 ELISA Kit (Ready to Use)
orb551691-01 48 Tests

Human NBL1 ELISA Kit (Ready to Use)

Sign In for Pricing
View Details
Human NBL1 ELISA Kit (Ready to Use)
orb551691-02 96 Tests

Human NBL1 ELISA Kit (Ready to Use)

Sign In for Pricing
View Details
RASA1 Rabbit Polyclonal Antibody (Cy7)
orb1059828 100 µL

RASA1 Rabbit Polyclonal Antibody (Cy7)

Sign In for Pricing
View Details
Xk sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
K3377905 3x 1.0 µg

Xk sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
Gabrr3 siRNA Oligos set (Rat)
21170176 3x 5 nmol

Gabrr3 siRNA Oligos set (Rat)

Sign In for Pricing
View Details
HLA Class II Histocompatibility Antigen Gamma Chain (CD74) Antibody (FITC)
abx443102 100 µg

HLA Class II Histocompatibility Antigen Gamma Chain (CD74) Antibody (FITC)

Sign In for Pricing
View Details