Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SDF-1 beta/CXCL12, Mouse

SDF-1 beta (Stromal-derived factor-1β, SDF-1β) is a stromal derived CXC chemokine that signal through the CXCR4 receptor. SDF-1β has chemotactic activity on B and T cells[1][2]. SDF-1 beta/CXCL12 Protein, Mouse is produced in E. coli, and consists of 72 amino acids (K22-M93) .

Product Specifications

Product Name Alternative

SDF-1 beta/CXCL12 Protein, Mouse, Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cxcl12-sdf-1-beta-protein-mouse.html

Purity

98.0

Smiles

KPVSLSYRCPCRFFESHIARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNKRLKM

Molecular Formula

20315 (Gene_ID) P40224-2 (K22-M93) (Accession)

Molecular Weight

Approximately 10 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Maria De La Luz Sierra, et al. Differential processing of stromal-derived factor-1alpha and stromal-derived factor-1beta explains functional diversity. Blood. 2004 Apr 1;103 (7) :2452-9.|[2]Zheng Jiang, et al. Contribution of SDF-1α/CXCR4 signaling to brain development and glioma progression. Neurosignals. 2013;21 (3-4) :240-58.|[3]Miroslaw Janowski. Functional diversity of SDF-1 splicing variants. Cell Adh Migr. 2009 Jul-Sep;3 (3) :243-9.|[4]Kleanthis Fytianos, et al. Anti-Fibrotic Effect of SDF-1β Overexpression in Bleomycin-Injured Rat Lung. Pharmaceutics. 2022 Aug 27;14 (9) :1803.|[5]Yuanyuan Tian, et al. KLF15 negatively regulates cardiac fibrosis by which SDF-1β attenuates cardiac fibrosis in type 2 diabetic mice. Toxicol Appl Pharmacol. 2021 Sep 15;427:115654.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human SPP1, His tagged
MK0706H 10 µg

Recombinant Human SPP1, His tagged

Sign In for Pricing
View Details
Porcine Biglycan (BGN) ELISA Kit
MBS2602077-01 48 Well

Porcine Biglycan (BGN) ELISA Kit

Sign In for Pricing
View Details
Porcine Biglycan (BGN) ELISA Kit
MBS2602077-02 96 Well

Porcine Biglycan (BGN) ELISA Kit

Sign In for Pricing
View Details
Porcine Biglycan (BGN) ELISA Kit
MBS2602077-03 5x 96 Well

Porcine Biglycan (BGN) ELISA Kit

Sign In for Pricing
View Details
Porcine Biglycan (BGN) ELISA Kit
MBS2602077-04 10x 96 Well

Porcine Biglycan (BGN) ELISA Kit

Sign In for Pricing
View Details
2-Bromoethanol 95% For Synthesis
0501D 00100 100 mL

2-Bromoethanol 95% For Synthesis

Sign In for Pricing
View Details