Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Gorilla gorilla gorilla Fibroblast growth factor

Product Specifications

Product Name Alternative

FGF

Abbreviation

Recombinant Gorilla gorilla gorilla Fibroblast growth factor protein

UniProt

G3QFY8

Expression Region

29-209aa

Organism

Gorilla gorilla gorilla (Western lowland gorilla)

Target Sequence

HPIPDSSPLLQFGGQVRQRYLYTDDAQQTEAHLEIREDGTVGGAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEACSFRELLLEDGYNVYQSEAHGLPLHLPGNKSPHRDPAPRGPARFLPLPGLPPAPPEPPGILAPQPPDVGSSDPLSMVGPSQGRSPSYAS

Tag

N-terminal 10xHis-tagged

Type

In Stock Protein

Source

In vitro E.coli expression system

Field of Research

Others

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

22.2 kDa

References & Citations

"Insights into the evolution of the great apes provided by the gorilla genome." Scally A. Submitted (MAY-2011)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ANGPTL1 (Angiopoietin-like 1, ANG3, ANGPT3, ARP1, AngY, KIAA0351, UNQ162, dJ595C2.2) (AP)
MBS6164084-01 0.1 mL

ANGPTL1 (Angiopoietin-like 1, ANG3, ANGPT3, ARP1, AngY, KIAA0351, UNQ162, dJ595C2.2) (AP)

Sign In for Pricing
View Details
ANGPTL1 (Angiopoietin-like 1, ANG3, ANGPT3, ARP1, AngY, KIAA0351, UNQ162, dJ595C2.2) (AP)
MBS6164084-02 5x 0.1 mL

ANGPTL1 (Angiopoietin-like 1, ANG3, ANGPT3, ARP1, AngY, KIAA0351, UNQ162, dJ595C2.2) (AP)

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana Uncharacterized mitochondrial protein AtMg00150 (AtMg00150) , partial
MBS7058799 Inquire

Recombinant Arabidopsis thaliana Uncharacterized mitochondrial protein AtMg00150 (AtMg00150) , partial

Sign In for Pricing
View Details
Kallikrein 5 (KLK5) Antibody
abx177252-01 200 µg

Kallikrein 5 (KLK5) Antibody

Sign In for Pricing
View Details
Kallikrein 5 (KLK5) Antibody
abx177252-02 1 mg

Kallikrein 5 (KLK5) Antibody

Sign In for Pricing
View Details
H2ac6 Mouse Gene Knockout Kit (CRISPR)
KN507737 1 Kit

H2ac6 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details