Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

APLN/Apelin, Human (HEK293, Fc)

APLN protein is an endogenous ligand for the apelin receptor (APLNR), drives receptor internalization, and dissociates more strongly from APLNR than (pyroglu) apelin-13. APLN/Apelin Protein, Human (HEK293, Fc) is the recombinant human-derived APLN protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

APLN/Apelin Protein, Human (HEK293, Fc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/apln-protein-human-hek293-fc.html

Purity

95.0

Smiles

GSLMPLPDGNGLEDGNVRHLVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF

Molecular Formula

8862 (Gene_ID) Q9ULZ1 (G23-F77) (Accession)

Molecular Weight

32-40 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Semaphorin 4D (SEMA4D) ELISA Kit
RDR-SEMA4D-Hu-01 96 Tests

Human Semaphorin 4D (SEMA4D) ELISA Kit

Sign In for Pricing
View Details
Human Semaphorin 4D (SEMA4D) ELISA Kit
RDR-SEMA4D-Hu-02 48 Tests

Human Semaphorin 4D (SEMA4D) ELISA Kit

Sign In for Pricing
View Details
Recombinant CTSO Antibody
RN-078-01 50 μL

Recombinant CTSO Antibody

Sign In for Pricing
View Details
Recombinant CTSO Antibody
RN-078-02 100 µL

Recombinant CTSO Antibody

Sign In for Pricing
View Details
Recombinant CTSO Antibody
RN-078-03 1 mL

Recombinant CTSO Antibody

Sign In for Pricing
View Details
B4GAT1 Polyclonal Antibody
E-AB-53589-01 20 µL

B4GAT1 Polyclonal Antibody

Sign In for Pricing
View Details