Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VEGF164, Mouse (P.pastoris)

VEGF164 Protein, Mouse (P.pastoris), a VEGF isoform splice variant, is more potent at inducing endothelial ICAM-1 expression by VEGFR-2, leukocyte migration by VEGFR-1, and inflammation and angiogenesis in the adult cornea.

Product Specifications

Product Name Alternative

VEGF164 Protein, Mouse (P.pastoris), Mouse, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/vegf164-protein-mouse-186a-a-p-pastoris.html

Purity

97.0

Smiles

MAPTTEGEQKSHEVIKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCAGCCNDEALECVPTSESNITMQIMRIKPHQSQHIGEMSFLQHSRCECRPKKDRTKPEKHCEPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR

Molecular Formula

22339 (Gene_ID) Q00731-2 (A27-R190) (Accession)

Molecular Weight

Approximately 39 kDa, based on SDS-PAGE under non reducing (N) conditions.

References & Citations

[1]Usui T, et al. VEGF164 (165) as the pathological isoform: differential leukocyte and endothelial responses through VEGFR1 and VEGFR2. Invest Ophthalmol Vis Sci. 2004 Feb;45 (2) :368-74.|[2]Ishida S, et al. VEGF164 is proinflammatory in the diabetic retina. Invest Ophthalmol Vis Sci. 2003 May;44 (5) :2155-62.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dleu7 ORF Vector (Rat) (pORF)
ORF066046 1.0 µg DNA

Dleu7 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
Integrin Beta 3 Binding Protein Human Recombinant
rAP-3492 1 Each

Integrin Beta 3 Binding Protein Human Recombinant

Sign In for Pricing
View Details
Mouse Ddr2 Pre-designed siRNA Set B
SI103489B 1 Each

Mouse Ddr2 Pre-designed siRNA Set B

Sign In for Pricing
View Details
C9orf61 (FAM189A2) (NM_004816) Human Over-expression Lysate
LH07382V 100 µg

C9orf61 (FAM189A2) (NM_004816) Human Over-expression Lysate

Sign In for Pricing
View Details
(4,5-dimethoxy-2-methylphenyl) (methyl) sulfane
OR1092610-01 250 mg

(4,5-dimethoxy-2-methylphenyl) (methyl) sulfane

Sign In for Pricing
View Details
(4,5-dimethoxy-2-methylphenyl) (methyl) sulfane
OR1092610-02 1 g

(4,5-dimethoxy-2-methylphenyl) (methyl) sulfane

Sign In for Pricing
View Details