Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LRG1, Human (HEK293, Fc-His)

Leucine-rich alpha-2-glycoprotein (encoded by LRG1) is a serum biomarkerof inflammatory bowel disease and various autoimmune diseases. LRG1 can bind to TGF-β1 (KD: 2.32 µM) and modulate the TGFβ pathway[1][2][3]. LRG1 Protein, Human (HEK293, Fc-His) is the recombinant human-derived LRG1 protein, expressed by HEK293 , with C-hFc, C-6*His labeled tag.

Product Specifications

Product Name Alternative

LRG1 Protein, Human (HEK293, Fc-His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/lrg1-protein-human-hek-293-fc-his.html

Purity

98.0

Smiles

VTLSPKDCQVFRSDHGSSISCQPPAEIPGYLPADTVHLAVEFFNLTHLPANLLQGASKLQELHLSSNGLESLSPEFLRPVPQLRVLDLTRNALTGLPPGLFQASATLDTLVLKENQLEVLEVSWLHGLKALGHLDLSGNRLRKLPPGLLANFTLLRTLDLGENQLETLPPDLLRGPLQLERLHLEGNKLQVLGKDLLLPQPDLRYLFLNGNKLARVAAGAFQGLRQLDMLDLSNNSLASVPEGLWASLGQPNWDMRDGFDISGNPWICDQNLSDLYRWLQAQKDKMFSQNDTRCAGPEAVKGQTLLAVAKSQ

Molecular Formula

116844 (Gene_ID) P02750/AAH70198.1 (V36-Q347) (Accession)

Molecular Weight

65-90 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD15 / FUT4 / Lewis x (FUT4/815 + BRA-4F1), 0.2mg/mL
BNUB0562-100 1x 100 µL

CD15 / FUT4 / Lewis x (FUT4/815 + BRA-4F1), 0.2mg/mL

Sign In for Pricing
View Details
Goat IgG Light chain Mouse Monoclonal Antibody [B8-C4-G4]
M0910-2 100 µL

Goat IgG Light chain Mouse Monoclonal Antibody [B8-C4-G4]

Sign In for Pricing
View Details
Oleanolic Acid
TRC-O521000-500MG 500 mg

Oleanolic Acid

Sign In for Pricing
View Details
Monocyclohexyl Phthalate-d4
TRC-M526602-5MG 5 mg

Monocyclohexyl Phthalate-d4

Sign In for Pricing
View Details
Cox16 Mouse Gene Knockout Kit (CRISPR)
KN503715 1 Kit

Cox16 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CD1a (O10), CF594 conjugate, 0.1mg/mL
BNC940667-500 1x 500 µL

CD1a (O10), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details