Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CEBP gamma/CEBPG, Human (His)

CEBP gamma/CEBPG protein is a transcription factor that regulates genes by binding to their promoter and enhancer regions. It targets IL-4 and immunoglobulin heavy chains, binding to enhancer elements PRE-I and GPE1 in the G-CSF gene promoter. CEBP gamma/CEBPG Protein, Human (His) is the recombinant human-derived CEBP gamma/CEBPG protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

CEBP gamma/CEBPG Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cebp-gamma-protein-human-his.html

Purity

94.70

Smiles

PGGGGKAVAPSKQSKKSSPMDRNSDEYRQRRERNNMAVKKSRLKSKQKAQDTLQRVNQLKEENERLEAKIKLLTKELSVLKDLFLEHAHNLADNVQSISTENTTADGDN

Molecular Formula

1054 (Gene_ID) P53567 (P39-N147) (Accession)

Molecular Weight

Approximately 16 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MUC2 (CCP58), CF405S conjugate, 0.1mg/mL
BNC040032-500 1x 500 µL

MUC2 (CCP58), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD86 (BU63), CF594 conjugate, 0.1mg/mL
BNC940193-500 1x 500 µL

CD86 (BU63), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD81 / TAPA-1 (1.3.3.22), CF770 conjugate, 0.1mg/mL
BNC700391-500 1x 500 µL

CD81 / TAPA-1 (1.3.3.22), CF770 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD71 (66IG10), CF405S conjugate, 0.1mg/mL
BNC040871-100 1x 100 µL

CD71 (66IG10), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD56 / NCAM (NCAM1/784), CF568 conjugate, 0.1mg/mL
BNC680784-500 1x 500 µL

CD56 / NCAM (NCAM1/784), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HER-2 / CD340 (HRB2/282), CF488A conjugate, 0.1mg/mL
BNC880282-500 1x 500 µL

HER-2 / CD340 (HRB2/282), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details