Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Serine protease 1 (PRSS1)

Product Specifications

Product Name Alternative

Beta-trypsin (Cationic trypsinogen) (Serine protease 1) (Trypsin I) (TRP1) (TRY1) (TRYP1)

Abbreviation

Recombinant Human PRSS1 protein

Gene Name

PRSS1

UniProt

P07477

Expression Region

24-247aa

Organism

Homo sapiens (Human)

Target Sequence

IVGGYNCEENSVPYQVSLNSGYHFCGGSLINEQWVVSAGHCYKSRIQVRLGEHNIEVLEGNEQFINAAKIIRHPQYDRKTLNNDIMLIKLSSRAVINARVSTISLPTAPPATGTKCLISGWGNTASSGADYPDELQCLDAPVLSQAKCEASYPGKITSNMFCVGFLEGGKDSCQGDSGGPVVCNGQLQGVVSWGDGCAQKNKPGVYTKVYNYVKWIKNTIAANS

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Metabolism

Relevance

Has activity against the synthetic substrates Boc-Phe-Ser-Arg-Mec, Boc-Leu-Thr-Arg-Mec, Boc-Gln-Ala-Arg-Mec and Boc-Val-Pro-Arg-Mec. The single-chain form is more active than the two-chain form against all of these substrates.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

31.6 kDa

References & Citations

"Cloning, characterization and nucleotide sequences of two cDNAs encoding human pancreatic trypsinogens." Emi M., Nakamura Y., Ogawa M., Yamamoto T., Nishide T., Mori T., Matsubara K. Gene 41:305-310 (1986)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Igfbp1 sgRNA CRISPR Lentivector (Rat) (Target 2)
K6775203 1.0 µg DNA

Igfbp1 sgRNA CRISPR Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
TMEM214 Antibody (N-term) Blocking peptide
MBS9217403-01 0.5 mg

TMEM214 Antibody (N-term) Blocking peptide

Sign In for Pricing
View Details
TMEM214 Antibody (N-term) Blocking peptide
MBS9217403-02 5x 0.5 mg

TMEM214 Antibody (N-term) Blocking peptide

Sign In for Pricing
View Details
Rat chemerin ELISA Kit
SL1034Ra-01 48 Tests

Rat chemerin ELISA Kit

Sign In for Pricing
View Details
Rat chemerin ELISA Kit
SL1034Ra-02 96 Tests

Rat chemerin ELISA Kit

Sign In for Pricing
View Details
HCAP G (NCAPG) (NM_022346) Human Untagged Clone
SC111395 10 µg

HCAP G (NCAPG) (NM_022346) Human Untagged Clone

Sign In for Pricing
View Details