Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Acyl-protein thioesterase 2/LYPLA2, Human (His)

Acyl-protein thioesterase 2/LYPLA2 Protein, Human (His) a protein palmitoyl thioesterase, is a cytosolic enzyme that catalyze depalmitoylation of membrane-anchored, growth-associated protein-43 (GAP-43) .

Product Specifications

Product Name Alternative

Acyl-protein thioesterase 2/LYPLA2 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/acyl-protein-thioesterase-2-lypla2-protein-human-his.html

Purity

95.0

Smiles

MCGNTMSVPLLTDAATVSGAERETAAVIFLHGLGDTGHSWADALSTIRLPHVKYICPHAPRIPVTLNMKMVMPSWFDLMGLSPDAPEDEAGIKKAAENIKALIEHEMKNGIPANRIVLGGFSQGGALSLYTALTCPHPLAGIVALSCWLPLHRAFPQAANGSAKDLAILQCHGELDPMVPVRFGALTAEKLRSVVTPARVQFKTYPGVMHSSCPQEMAAVKEFLEKLLPPV

Molecular Formula

11313 (Gene_ID) O95372 (M1-V231) (Accession)

Molecular Weight

Approximately 28.0 kDa

References & Citations

[1]Eryan Kong, et al. Dynamic palmitoylation links cytosol-membrane shuttling of acyl-protein thioesterase-1 and acyl-protein thioesterase-2 with that of proto-oncogene H-ras product and growth-associated protein-43. J Biol Chem. 2013 Mar 29;288 (13) :9112-25.

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

DGKA antibody
10R-8135 100 ug

DGKA antibody

Ask
View Details
CD49b (CD49b Antigen, Alpha 2 Subunit of VLA2 Receptor, Alpha 2 Subunit of VLA-2 Receptor, Collagen Receptor, GPIa, Integrin alpha 2, ITGA2, Platelet Antigen Br, Platelet Glycoprotein GPIa, Platelet Glycoprotein Ia, Platelet Membrane Glycoprotein Ia, Very
MBS6247681-01 0.1 mL

CD49b (CD49b Antigen, Alpha 2 Subunit of VLA2 Receptor, Alpha 2 Subunit of VLA-2 Receptor, Collagen Receptor, GPIa, Integrin alpha 2, ITGA2, Platelet Antigen Br, Platelet Glycoprotein GPIa, Platelet Glycoprotein Ia, Platelet Membrane Glycoprotein Ia, Very

Ask
View Details
CD49b (CD49b Antigen, Alpha 2 Subunit of VLA2 Receptor, Alpha 2 Subunit of VLA-2 Receptor, Collagen Receptor, GPIa, Integrin alpha 2, ITGA2, Platelet Antigen Br, Platelet Glycoprotein GPIa, Platelet Glycoprotein Ia, Platelet Membrane Glycoprotein Ia, Very
MBS6247681-02 5x 0.1 mL

CD49b (CD49b Antigen, Alpha 2 Subunit of VLA2 Receptor, Alpha 2 Subunit of VLA-2 Receptor, Collagen Receptor, GPIa, Integrin alpha 2, ITGA2, Platelet Antigen Br, Platelet Glycoprotein GPIa, Platelet Glycoprotein Ia, Platelet Membrane Glycoprotein Ia, Very

Ask
View Details
pDNR-LIB-ACP3 Plasmid
PVT27199 2 µg

pDNR-LIB-ACP3 Plasmid

Ask
View Details
BFAR, CT (Bifunctional Apoptosis Regulator, RING Finger Protein 47, BAR, RNF47)
MBS641820-01 0.05 mg

BFAR, CT (Bifunctional Apoptosis Regulator, RING Finger Protein 47, BAR, RNF47)

Ask
View Details
BFAR, CT (Bifunctional Apoptosis Regulator, RING Finger Protein 47, BAR, RNF47)
MBS641820-02 5x 0.05 mg

BFAR, CT (Bifunctional Apoptosis Regulator, RING Finger Protein 47, BAR, RNF47)

Ask
View Details