Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Acyl-protein thioesterase 2/LYPLA2, Human (His)

Acyl-protein thioesterase 2/LYPLA2 Protein, Human (His) a protein palmitoyl thioesterase, is a cytosolic enzyme that catalyze depalmitoylation of membrane-anchored, growth-associated protein-43 (GAP-43) .

Product Specifications

Product Name Alternative

Acyl-protein thioesterase 2/LYPLA2 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/acyl-protein-thioesterase-2-lypla2-protein-human-his.html

Purity

95.0

Smiles

MCGNTMSVPLLTDAATVSGAERETAAVIFLHGLGDTGHSWADALSTIRLPHVKYICPHAPRIPVTLNMKMVMPSWFDLMGLSPDAPEDEAGIKKAAENIKALIEHEMKNGIPANRIVLGGFSQGGALSLYTALTCPHPLAGIVALSCWLPLHRAFPQAANGSAKDLAILQCHGELDPMVPVRFGALTAEKLRSVVTPARVQFKTYPGVMHSSCPQEMAAVKEFLEKLLPPV

Molecular Formula

11313 (Gene_ID) O95372 (M1-V231) (Accession)

Molecular Weight

Approximately 28.0 kDa

References & Citations

[1]Eryan Kong, et al. Dynamic palmitoylation links cytosol-membrane shuttling of acyl-protein thioesterase-1 and acyl-protein thioesterase-2 with that of proto-oncogene H-ras product and growth-associated protein-43. J Biol Chem. 2013 Mar 29;288 (13) :9112-25.

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

GENLISA™ Human Runt Related Transcription Factor 3 (RUNX3) ELISA
KBH22313 1x 96 Well

GENLISA™ Human Runt Related Transcription Factor 3 (RUNX3) ELISA

Ask
View Details
HSPC142 (BRCA1-A Complex Subunit MERIT40, Chromosome 19 Open Reading Frame 62, C19orf62, FLJ20571, Mediator of RAP80 Interactions and Targeting Subunit of 40kD, MERIT40, New Component of the BRCA1-A Complex, NBA1) (MaxLight 750)
MBS6481204-01 0.1 mL

HSPC142 (BRCA1-A Complex Subunit MERIT40, Chromosome 19 Open Reading Frame 62, C19orf62, FLJ20571, Mediator of RAP80 Interactions and Targeting Subunit of 40kD, MERIT40, New Component of the BRCA1-A Complex, NBA1) (MaxLight 750)

Ask
View Details
HSPC142 (BRCA1-A Complex Subunit MERIT40, Chromosome 19 Open Reading Frame 62, C19orf62, FLJ20571, Mediator of RAP80 Interactions and Targeting Subunit of 40kD, MERIT40, New Component of the BRCA1-A Complex, NBA1) (MaxLight 750)
MBS6481204-02 5x 0.1 mL

HSPC142 (BRCA1-A Complex Subunit MERIT40, Chromosome 19 Open Reading Frame 62, C19orf62, FLJ20571, Mediator of RAP80 Interactions and Targeting Subunit of 40kD, MERIT40, New Component of the BRCA1-A Complex, NBA1) (MaxLight 750)

Ask
View Details
Acads (NM_022512) Rat Tagged Lenti ORF Clone
RR211335L3 10 µg

Acads (NM_022512) Rat Tagged Lenti ORF Clone

Ask
View Details
TBL1X Antibody
GWB-B04CD0 0.1 mg

TBL1X Antibody

Ask
View Details
Cyclobutane-1,2,3,4-tetracarboxylic dianhydride
JH301307 1 Each

Cyclobutane-1,2,3,4-tetracarboxylic dianhydride

Ask
View Details