Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Acyl-protein thioesterase 2/LYPLA2, Human (His)

Acyl-protein thioesterase 2/LYPLA2 Protein, Human (His) a protein palmitoyl thioesterase, is a cytosolic enzyme that catalyze depalmitoylation of membrane-anchored, growth-associated protein-43 (GAP-43) .

Product Specifications

Product Name Alternative

Acyl-protein thioesterase 2/LYPLA2 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/acyl-protein-thioesterase-2-lypla2-protein-human-his.html

Purity

95.0

Smiles

MCGNTMSVPLLTDAATVSGAERETAAVIFLHGLGDTGHSWADALSTIRLPHVKYICPHAPRIPVTLNMKMVMPSWFDLMGLSPDAPEDEAGIKKAAENIKALIEHEMKNGIPANRIVLGGFSQGGALSLYTALTCPHPLAGIVALSCWLPLHRAFPQAANGSAKDLAILQCHGELDPMVPVRFGALTAEKLRSVVTPARVQFKTYPGVMHSSCPQEMAAVKEFLEKLLPPV

Molecular Formula

11313 (Gene_ID) O95372 (M1-V231) (Accession)

Molecular Weight

Approximately 28.0 kDa

References & Citations

[1]Eryan Kong, et al. Dynamic palmitoylation links cytosol-membrane shuttling of acyl-protein thioesterase-1 and acyl-protein thioesterase-2 with that of proto-oncogene H-ras product and growth-associated protein-43. J Biol Chem. 2013 Mar 29;288 (13) :9112-25.

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Bovine Pleckstrin homology-like domain family A member 2 ELISA Kit
MBS2881167-01 48 Well

Bovine Pleckstrin homology-like domain family A member 2 ELISA Kit

Ask
View Details
Bovine Pleckstrin homology-like domain family A member 2 ELISA Kit
MBS2881167-02 96 Well

Bovine Pleckstrin homology-like domain family A member 2 ELISA Kit

Ask
View Details
Bovine Pleckstrin homology-like domain family A member 2 ELISA Kit
MBS2881167-03 5x 96 Well

Bovine Pleckstrin homology-like domain family A member 2 ELISA Kit

Ask
View Details
Bovine Pleckstrin homology-like domain family A member 2 ELISA Kit
MBS2881167-04 10x 96 Well

Bovine Pleckstrin homology-like domain family A member 2 ELISA Kit

Ask
View Details
UBAP1 Antibody, Biotin conjugated
A68536-50UG 50 µg

UBAP1 Antibody, Biotin conjugated

Ask
View Details
Human Glucosidase Beta Acid ELISA Kit
ELA-E2511h 96 Tests

Human Glucosidase Beta Acid ELISA Kit

Ask
View Details