Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD3 gamma, Cynomolgus (P.pastoris, His)

CD3γ protein on lymphocytes is a component of the TCR-CD3 complex and is critical for adaptive immune responses. When the TCR is activated, CD3D, CD3E, CD3G, and CD3Z transmit TCR-mediated signals and activate downstream pathways. CD3 gamma Protein, Cynomolgus (P.pastoris, His) is the recombinant cynomolgus-derived CD3 gamma protein, expressed by P. pastoris , with N-His labeled tag.

Product Specifications

Product Name Alternative

CD3 gamma Protein, Cynomolgus (P.pastoris, His), Cynomolgus, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd3-gamma-protein-cynomolgus-p-pastoris-his.html

Smiles

QSFEENRKLNVYNQEDGSVLLTCHVKNTNITWFKEGKMIDILTAHKNKWNLGSNTKDPRGVYQCKGSKDKSKTLQVYYRMCQNCIELNAAT

Molecular Formula

102134381 (Gene_ID) Q95LI7 (Q23-T113) (Accession)

Molecular Weight

Approximately 12.5 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-Amino-6-ethyl-3-propylquinoline hydrochloride
sc-287764 250 mg

2-Amino-6-ethyl-3-propylquinoline hydrochloride

Sign In for Pricing
View Details
IGHD6-6 3'UTR GFP Stable Cell Line
TU060581 1.0 mL

IGHD6-6 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
CCKBR Antibody
A16272-100UL 100 µL

CCKBR Antibody

Sign In for Pricing
View Details
(+) -Catechin hydrate
GL6828-10g 10 g

(+) -Catechin hydrate

Sign In for Pricing
View Details
GMD (C-7) Alexa Fluor® 488
sc-515226 AF488 200 µg/mL

GMD (C-7) Alexa Fluor® 488

Sign In for Pricing
View Details
Hsa-miR-6744-3p agomir
HY-R02045A-01 5 nmol

Hsa-miR-6744-3p agomir

Sign In for Pricing
View Details