CD3 gamma, Cynomolgus (P.pastoris, His)
CD3γ protein on lymphocytes is a component of the TCR-CD3 complex and is critical for adaptive immune responses. When the TCR is activated, CD3D, CD3E, CD3G, and CD3Z transmit TCR-mediated signals and activate downstream pathways. CD3 gamma Protein, Cynomolgus (P.pastoris, His) is the recombinant cynomolgus-derived CD3 gamma protein, expressed by P. pastoris , with N-His labeled tag.
Product Specifications
Product Name Alternative
CD3 gamma Protein, Cynomolgus (P.pastoris, His), Cynomolgus, P. pastoris
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/cd3-gamma-protein-cynomolgus-p-pastoris-his.html
Smiles
QSFEENRKLNVYNQEDGSVLLTCHVKNTNITWFKEGKMIDILTAHKNKWNLGSNTKDPRGVYQCKGSKDKSKTLQVYYRMCQNCIELNAAT
Molecular Formula
102134381 (Gene_ID) Q95LI7 (Q23-T113) (Accession)
Molecular Weight
Approximately 12.5 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Scientific Category
Recombinant Proteins
Explore Other Products
Browse additional items from our catalog
Rabbit Polyclonal Gastrin-releasing Peptide R/GRPR Antibody
GTF2IRD1 Human shRNA Lentiviral Particle (Locus ID 9569)
ELISA kit for Mouse Grb10 (Growth Factor Receptor Bound Protein 10)
ING2, ID (ING2, ING1L, Inhibitor of growth protein 2, Inhibitor of growth 1-like protein, p32, p33ING2) (Azide free) (HRP)