CD3 gamma, Cynomolgus (P.pastoris, His)
CD3γ protein on lymphocytes is a component of the TCR-CD3 complex and is critical for adaptive immune responses. When the TCR is activated, CD3D, CD3E, CD3G, and CD3Z transmit TCR-mediated signals and activate downstream pathways. CD3 gamma Protein, Cynomolgus (P.pastoris, His) is the recombinant cynomolgus-derived CD3 gamma protein, expressed by P. pastoris , with N-His labeled tag.
Product Specifications
Product Name Alternative
CD3 gamma Protein, Cynomolgus (P.pastoris, His), Cynomolgus, P. pastoris
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/cd3-gamma-protein-cynomolgus-p-pastoris-his.html
Smiles
QSFEENRKLNVYNQEDGSVLLTCHVKNTNITWFKEGKMIDILTAHKNKWNLGSNTKDPRGVYQCKGSKDKSKTLQVYYRMCQNCIELNAAT
Molecular Formula
102134381 (Gene_ID) Q95LI7 (Q23-T113) (Accession)
Molecular Weight
Approximately 12.5 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Scientific Category
Recombinant Proteins
Explore Other Products
Browse additional items from our catalog
Human Alpha- (1, 3)-fucosyltransferase, FUT7 ELISA Kit
Human Alpha- (1, 3)-fucosyltransferase, FUT7 ELISA Kit
Human Alpha- (1, 3)-fucosyltransferase, FUT7 ELISA Kit
Human Alpha- (1, 3)-fucosyltransferase, FUT7 ELISA Kit