Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD3 gamma, Cynomolgus (P.pastoris, His)

CD3γ protein on lymphocytes is a component of the TCR-CD3 complex and is critical for adaptive immune responses. When the TCR is activated, CD3D, CD3E, CD3G, and CD3Z transmit TCR-mediated signals and activate downstream pathways. CD3 gamma Protein, Cynomolgus (P.pastoris, His) is the recombinant cynomolgus-derived CD3 gamma protein, expressed by P. pastoris , with N-His labeled tag.

Product Specifications

Product Name Alternative

CD3 gamma Protein, Cynomolgus (P.pastoris, His), Cynomolgus, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd3-gamma-protein-cynomolgus-p-pastoris-his.html

Smiles

QSFEENRKLNVYNQEDGSVLLTCHVKNTNITWFKEGKMIDILTAHKNKWNLGSNTKDPRGVYQCKGSKDKSKTLQVYYRMCQNCIELNAAT

Molecular Formula

102134381 (Gene_ID) Q95LI7 (Q23-T113) (Accession)

Molecular Weight

Approximately 12.5 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human EML2 (Echinoderm Microtubule Associated Protein Like Protein 2) ELISA Kit
ELK6897-01 48 Tests

Human EML2 (Echinoderm Microtubule Associated Protein Like Protein 2) ELISA Kit

Sign In for Pricing
View Details
Human EML2 (Echinoderm Microtubule Associated Protein Like Protein 2) ELISA Kit
ELK6897-02 96 Tests

Human EML2 (Echinoderm Microtubule Associated Protein Like Protein 2) ELISA Kit

Sign In for Pricing
View Details
Human EML2 (Echinoderm Microtubule Associated Protein Like Protein 2) ELISA Kit
ELK6897-03 5x 96 Tests

Human EML2 (Echinoderm Microtubule Associated Protein Like Protein 2) ELISA Kit

Sign In for Pricing
View Details
Mouse 50% complement hemolysis (CH50) ELISA Kit
EIA05473m 1 Kit

Mouse 50% complement hemolysis (CH50) ELISA Kit

Sign In for Pricing
View Details
MARCH7 Antibody (N-term)
MBS9202054-01 0.08 mL

MARCH7 Antibody (N-term)

Sign In for Pricing
View Details
MARCH7 Antibody (N-term)
MBS9202054-02 0.4 mL

MARCH7 Antibody (N-term)

Sign In for Pricing
View Details