Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD3 gamma, Cynomolgus (P.pastoris, His)

CD3γ protein on lymphocytes is a component of the TCR-CD3 complex and is critical for adaptive immune responses. When the TCR is activated, CD3D, CD3E, CD3G, and CD3Z transmit TCR-mediated signals and activate downstream pathways. CD3 gamma Protein, Cynomolgus (P.pastoris, His) is the recombinant cynomolgus-derived CD3 gamma protein, expressed by P. pastoris , with N-His labeled tag.

Product Specifications

Product Name Alternative

CD3 gamma Protein, Cynomolgus (P.pastoris, His), Cynomolgus, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd3-gamma-protein-cynomolgus-p-pastoris-his.html

Smiles

QSFEENRKLNVYNQEDGSVLLTCHVKNTNITWFKEGKMIDILTAHKNKWNLGSNTKDPRGVYQCKGSKDKSKTLQVYYRMCQNCIELNAAT

Molecular Formula

102134381 (Gene_ID) Q95LI7 (Q23-T113) (Accession)

Molecular Weight

Approximately 12.5 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

Big Endothelin-1 (1-31) (human, bovine)
M40161-01 100 mg

Big Endothelin-1 (1-31) (human, bovine)

Sign In for Pricing
View Details
Big Endothelin-1 (1-31) (human, bovine)
M40161-02 25 mg

Big Endothelin-1 (1-31) (human, bovine)

Sign In for Pricing
View Details
Big Endothelin-1 (1-31) (human, bovine)
M40161-03 50 mg

Big Endothelin-1 (1-31) (human, bovine)

Sign In for Pricing
View Details
Big Endothelin-1 (1-31) (human, bovine)
M40161-04 500 mg

Big Endothelin-1 (1-31) (human, bovine)

Sign In for Pricing
View Details
Big Endothelin-1 (1-31) (human, bovine)
M40161-05 Inquire

Big Endothelin-1 (1-31) (human, bovine)

Sign In for Pricing
View Details
Homeobox Protein Hox-D12 (HOXD12) Peptide
abx616980 100 µg

Homeobox Protein Hox-D12 (HOXD12) Peptide

Sign In for Pricing
View Details