Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HO-1, Mouse (P. pastoris, His)

HO-1 Protein catalyzes the oxidative cleavage of heme, releasing carbon monoxide (CO) and ferrous iron. It provides protection against programmed cell death by catabolizing free heme, preventing apoptosis sensitization. HO-1 Protein, Mouse (P. pastoris, His) is the recombinant mouse-derived HO-1 protein, expressed by P. pastoris , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

HO-1 Protein, Mouse (P. pastoris, His), Mouse, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fetal-tau-0n3r-protein-human-his.html

Purity

91

Smiles

MERPQPDSMPQDLSEALKEATKEVHIQAENAEFMKNFQKGQVSREGFKLVMASLYHIYTALEEEIERNKQNPVYAPLYFPEELHRRAALEQDMAFWYGPHWQEIIPCTPATQHYVKRLHEVGRTHPELLVAHAYTRYLGDLSGGQVLKKIAQKAMALPSSGEGLAFFTFPNIDSPTKFKQLYRARMNTLEMTPEVKHRVTEEAKTAFLLNIELFEELQVMLTEEHKDQSPSQMASLRQRPASLVQDTAPAETPRGKPQISTSSSQTPLLQWVLTLSFLLATVAVGIYAM

Molecular Formula

15368 (Gene_ID) P14901 (M1-M289) (Accession)

Molecular Weight

Approximately 31 KDa & 34 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

DYNC1H1 Antibody
A20020-100UL 100 µL

DYNC1H1 Antibody

Sign In for Pricing
View Details
Goat Carnitine O-palmitoyltransferase 1, liver isoform (CPT1A/CPT1) ELISA Kit
MBS7213156-01 48 Well

Goat Carnitine O-palmitoyltransferase 1, liver isoform (CPT1A/CPT1) ELISA Kit

Sign In for Pricing
View Details
Goat Carnitine O-palmitoyltransferase 1, liver isoform (CPT1A/CPT1) ELISA Kit
MBS7213156-02 96 Well

Goat Carnitine O-palmitoyltransferase 1, liver isoform (CPT1A/CPT1) ELISA Kit

Sign In for Pricing
View Details
Goat Carnitine O-palmitoyltransferase 1, liver isoform (CPT1A/CPT1) ELISA Kit
MBS7213156-03 5x 96 Well

Goat Carnitine O-palmitoyltransferase 1, liver isoform (CPT1A/CPT1) ELISA Kit

Sign In for Pricing
View Details
Goat Carnitine O-palmitoyltransferase 1, liver isoform (CPT1A/CPT1) ELISA Kit
MBS7213156-04 10x 96 Well

Goat Carnitine O-palmitoyltransferase 1, liver isoform (CPT1A/CPT1) ELISA Kit

Sign In for Pricing
View Details
PEnCMV-NUCKS1 (human) -3xFLAG-SV40-Neo
BZ39966 1 Vial

PEnCMV-NUCKS1 (human) -3xFLAG-SV40-Neo

Sign In for Pricing
View Details