Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HO-1, Mouse (P. pastoris, His)

HO-1 Protein catalyzes the oxidative cleavage of heme, releasing carbon monoxide (CO) and ferrous iron. It provides protection against programmed cell death by catabolizing free heme, preventing apoptosis sensitization. HO-1 Protein, Mouse (P. pastoris, His) is the recombinant mouse-derived HO-1 protein, expressed by P. pastoris , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

HO-1 Protein, Mouse (P. pastoris, His), Mouse, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fetal-tau-0n3r-protein-human-his.html

Purity

91

Smiles

MERPQPDSMPQDLSEALKEATKEVHIQAENAEFMKNFQKGQVSREGFKLVMASLYHIYTALEEEIERNKQNPVYAPLYFPEELHRRAALEQDMAFWYGPHWQEIIPCTPATQHYVKRLHEVGRTHPELLVAHAYTRYLGDLSGGQVLKKIAQKAMALPSSGEGLAFFTFPNIDSPTKFKQLYRARMNTLEMTPEVKHRVTEEAKTAFLLNIELFEELQVMLTEEHKDQSPSQMASLRQRPASLVQDTAPAETPRGKPQISTSSSQTPLLQWVLTLSFLLATVAVGIYAM

Molecular Formula

15368 (Gene_ID) P14901 (M1-M289) (Accession)

Molecular Weight

Approximately 31 KDa & 34 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-PTPN11 (Y580) Antibody
A25868-50UG 50 µg

Phospho-PTPN11 (Y580) Antibody

Sign In for Pricing
View Details
Biotinylated Anti-CD30 antibody (DM105) ; Rabbit mAb
12-9279B-100 100 µg

Biotinylated Anti-CD30 antibody (DM105) ; Rabbit mAb

Sign In for Pricing
View Details
RGD1311678 Protein Vector (Rat) (pPB-C-His)
PV299994 500 ng

RGD1311678 Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details
Recombinant Mouse IGFBP-7 protein (C-6His)
CD00402-01 10 µg

Recombinant Mouse IGFBP-7 protein (C-6His)

Sign In for Pricing
View Details
Recombinant Mouse IGFBP-7 protein (C-6His)
CD00402-02 50 µg

Recombinant Mouse IGFBP-7 protein (C-6His)

Sign In for Pricing
View Details
ZNF384, CT (ZNF384, CAGH1, CIZ, NMP4, TNRC1, Zinc finger protein 384, CAG repeat protein 1, CAS-interacting zinc finger protein, Nuclear matrix transcription factor 4, Trinucleotide repeat-containing gene 1 protein) (Azide free) (HRP)
MBS6366419-01 0.2 mL

ZNF384, CT (ZNF384, CAGH1, CIZ, NMP4, TNRC1, Zinc finger protein 384, CAG repeat protein 1, CAS-interacting zinc finger protein, Nuclear matrix transcription factor 4, Trinucleotide repeat-containing gene 1 protein) (Azide free) (HRP)

Sign In for Pricing
View Details