Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HO-1, Mouse (P. pastoris, His)

HO-1 Protein catalyzes the oxidative cleavage of heme, releasing carbon monoxide (CO) and ferrous iron. It provides protection against programmed cell death by catabolizing free heme, preventing apoptosis sensitization. HO-1 Protein, Mouse (P. pastoris, His) is the recombinant mouse-derived HO-1 protein, expressed by P. pastoris , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

HO-1 Protein, Mouse (P. pastoris, His), Mouse, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fetal-tau-0n3r-protein-human-his.html

Purity

91

Smiles

MERPQPDSMPQDLSEALKEATKEVHIQAENAEFMKNFQKGQVSREGFKLVMASLYHIYTALEEEIERNKQNPVYAPLYFPEELHRRAALEQDMAFWYGPHWQEIIPCTPATQHYVKRLHEVGRTHPELLVAHAYTRYLGDLSGGQVLKKIAQKAMALPSSGEGLAFFTFPNIDSPTKFKQLYRARMNTLEMTPEVKHRVTEEAKTAFLLNIELFEELQVMLTEEHKDQSPSQMASLRQRPASLVQDTAPAETPRGKPQISTSSSQTPLLQWVLTLSFLLATVAVGIYAM

Molecular Formula

15368 (Gene_ID) P14901 (M1-M289) (Accession)

Molecular Weight

Approximately 31 KDa & 34 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PC4 (SUB1) CytoSection
TS404999P5 25 Slides

PC4 (SUB1) CytoSection

Sign In for Pricing
View Details
LCE3B siRNA (Human)
MBS8204492-01 15 nmol

LCE3B siRNA (Human)

Sign In for Pricing
View Details
LCE3B siRNA (Human)
MBS8204492-02 30 nmol

LCE3B siRNA (Human)

Sign In for Pricing
View Details
LCE3B siRNA (Human)
MBS8204492-03 5x 30 nmol

LCE3B siRNA (Human)

Sign In for Pricing
View Details
Anti-Epidermal Growth Factor Receptor Antibody (Anti-EGFR) BioAssayTM ELISA Kit (Human)
588974 96 Tests

Anti-Epidermal Growth Factor Receptor Antibody (Anti-EGFR) BioAssayTM ELISA Kit (Human)

Sign In for Pricing
View Details
Human CEACAM1 (Carcinoembryonic Antigen Related Cell Adhesion Molecule 1) ELISA Kit
EH26563 96 Tests

Human CEACAM1 (Carcinoembryonic Antigen Related Cell Adhesion Molecule 1) ELISA Kit

Sign In for Pricing
View Details