Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HO-1, Mouse (P. pastoris, His)

HO-1 Protein catalyzes the oxidative cleavage of heme, releasing carbon monoxide (CO) and ferrous iron. It provides protection against programmed cell death by catabolizing free heme, preventing apoptosis sensitization. HO-1 Protein, Mouse (P. pastoris, His) is the recombinant mouse-derived HO-1 protein, expressed by P. pastoris , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

HO-1 Protein, Mouse (P. pastoris, His), Mouse, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fetal-tau-0n3r-protein-human-his.html

Purity

91

Smiles

MERPQPDSMPQDLSEALKEATKEVHIQAENAEFMKNFQKGQVSREGFKLVMASLYHIYTALEEEIERNKQNPVYAPLYFPEELHRRAALEQDMAFWYGPHWQEIIPCTPATQHYVKRLHEVGRTHPELLVAHAYTRYLGDLSGGQVLKKIAQKAMALPSSGEGLAFFTFPNIDSPTKFKQLYRARMNTLEMTPEVKHRVTEEAKTAFLLNIELFEELQVMLTEEHKDQSPSQMASLRQRPASLVQDTAPAETPRGKPQISTSSSQTPLLQWVLTLSFLLATVAVGIYAM

Molecular Formula

15368 (Gene_ID) P14901 (M1-M289) (Accession)

Molecular Weight

Approximately 31 KDa & 34 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Prostatic Binding Protein PBP Mab ELISA Kit
BG-MUS11885 1 Each

Mouse Prostatic Binding Protein PBP Mab ELISA Kit

Sign In for Pricing
View Details
P2ry10 ORF Vector (Rat) (pORF)
ORF073025 1.0 µg DNA

P2ry10 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
GAB1 Antibody
A59940-100UL 100 µL

GAB1 Antibody

Sign In for Pricing
View Details
Monkey CDK-7 ELISA Kit
EMKC0732 96 Tests

Monkey CDK-7 ELISA Kit

Sign In for Pricing
View Details
Frozen Tissue Sections, Colon
CS616112 5x 5 µm

Frozen Tissue Sections, Colon

Sign In for Pricing
View Details
XPA / XPAC (1-273, His-tag) Human Protein
AR50756PU-S 100 µg

XPA / XPAC (1-273, His-tag) Human Protein

Sign In for Pricing
View Details