Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HO-1, Mouse (P. pastoris, His)

HO-1 Protein catalyzes the oxidative cleavage of heme, releasing carbon monoxide (CO) and ferrous iron. It provides protection against programmed cell death by catabolizing free heme, preventing apoptosis sensitization. HO-1 Protein, Mouse (P. pastoris, His) is the recombinant mouse-derived HO-1 protein, expressed by P. pastoris , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

HO-1 Protein, Mouse (P. pastoris, His), Mouse, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fetal-tau-0n3r-protein-human-his.html

Purity

91

Smiles

MERPQPDSMPQDLSEALKEATKEVHIQAENAEFMKNFQKGQVSREGFKLVMASLYHIYTALEEEIERNKQNPVYAPLYFPEELHRRAALEQDMAFWYGPHWQEIIPCTPATQHYVKRLHEVGRTHPELLVAHAYTRYLGDLSGGQVLKKIAQKAMALPSSGEGLAFFTFPNIDSPTKFKQLYRARMNTLEMTPEVKHRVTEEAKTAFLLNIELFEELQVMLTEEHKDQSPSQMASLRQRPASLVQDTAPAETPRGKPQISTSSSQTPLLQWVLTLSFLLATVAVGIYAM

Molecular Formula

15368 (Gene_ID) P14901 (M1-M289) (Accession)

Molecular Weight

Approximately 31 KDa & 34 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF513 Human qPCR Primer Pair (NM_144631)
HP217221 200 Reactions

ZNF513 Human qPCR Primer Pair (NM_144631)

Sign In for Pricing
View Details
Mouse Monoclonal STRO-1 Antibody (STRO-1)
NBP1-48356SS 0.025 mL

Mouse Monoclonal STRO-1 Antibody (STRO-1)

Sign In for Pricing
View Details
CAPON (Carboxyl-terminal PDZ Ligand of Neuronal Nitric Oxide Synthase Protein, C-terminal PDZ Ligand of Neuronal Nitric Oxide Synthase Protein, Nitric Oxide Synthase 1 Adaptor Protein, NOS1AP, KIAA0464)
C1035-39A 100 µg

CAPON (Carboxyl-terminal PDZ Ligand of Neuronal Nitric Oxide Synthase Protein, C-terminal PDZ Ligand of Neuronal Nitric Oxide Synthase Protein, Nitric Oxide Synthase 1 Adaptor Protein, NOS1AP, KIAA0464)

Sign In for Pricing
View Details
Ensa sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)
K4712606 1.0 µg DNA

Ensa sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
Mocs2 sgRNA CRISPR Lentivector (Mouse) (Target 2)
K3949103 1.0 µg DNA

Mocs2 sgRNA CRISPR Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
GammaBind G Type 2
TEPRP-0208 5 mg

GammaBind G Type 2

Sign In for Pricing
View Details