Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HO-1, Mouse (P. pastoris, His)

HO-1 Protein catalyzes the oxidative cleavage of heme, releasing carbon monoxide (CO) and ferrous iron. It provides protection against programmed cell death by catabolizing free heme, preventing apoptosis sensitization. HO-1 Protein, Mouse (P. pastoris, His) is the recombinant mouse-derived HO-1 protein, expressed by P. pastoris , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

HO-1 Protein, Mouse (P. pastoris, His), Mouse, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fetal-tau-0n3r-protein-human-his.html

Purity

91

Smiles

MERPQPDSMPQDLSEALKEATKEVHIQAENAEFMKNFQKGQVSREGFKLVMASLYHIYTALEEEIERNKQNPVYAPLYFPEELHRRAALEQDMAFWYGPHWQEIIPCTPATQHYVKRLHEVGRTHPELLVAHAYTRYLGDLSGGQVLKKIAQKAMALPSSGEGLAFFTFPNIDSPTKFKQLYRARMNTLEMTPEVKHRVTEEAKTAFLLNIELFEELQVMLTEEHKDQSPSQMASLRQRPASLVQDTAPAETPRGKPQISTSSSQTPLLQWVLTLSFLLATVAVGIYAM

Molecular Formula

15368 (Gene_ID) P14901 (M1-M289) (Accession)

Molecular Weight

Approximately 31 KDa & 34 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

BMX (NM_001721) Human Over-expression Lysate
LC400648 20 µg

BMX (NM_001721) Human Over-expression Lysate

Sign In for Pricing
View Details
Canine Neuronal Cell Adhesion Molecule (NRCAM) ELISA Kit-Sandwich
EK10F904-01 48 Test

Canine Neuronal Cell Adhesion Molecule (NRCAM) ELISA Kit-Sandwich

Sign In for Pricing
View Details
Canine Neuronal Cell Adhesion Molecule (NRCAM) ELISA Kit-Sandwich
EK10F904-02 96 Tests

Canine Neuronal Cell Adhesion Molecule (NRCAM) ELISA Kit-Sandwich

Sign In for Pricing
View Details
Bromodeoxyuridine (Bromodeoxyuridine, BUdr, BrdU) (FITC)
172037-AF-FITC 100 µL

Bromodeoxyuridine (Bromodeoxyuridine, BUdr, BrdU) (FITC)

Sign In for Pricing
View Details
JAK1 (NM_002227) Human Tagged ORF Clone Lentiviral Particle
RC213878L3V 200 µL

JAK1 (NM_002227) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
50nm Endotoxin Free NanoUrchins
UEF-50-500 500 mL

50nm Endotoxin Free NanoUrchins

Sign In for Pricing
View Details