Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HO-1, Mouse (P. pastoris, His)

HO-1 Protein catalyzes the oxidative cleavage of heme, releasing carbon monoxide (CO) and ferrous iron. It provides protection against programmed cell death by catabolizing free heme, preventing apoptosis sensitization. HO-1 Protein, Mouse (P. pastoris, His) is the recombinant mouse-derived HO-1 protein, expressed by P. pastoris , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

HO-1 Protein, Mouse (P. pastoris, His), Mouse, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fetal-tau-0n3r-protein-human-his.html

Purity

91

Smiles

MERPQPDSMPQDLSEALKEATKEVHIQAENAEFMKNFQKGQVSREGFKLVMASLYHIYTALEEEIERNKQNPVYAPLYFPEELHRRAALEQDMAFWYGPHWQEIIPCTPATQHYVKRLHEVGRTHPELLVAHAYTRYLGDLSGGQVLKKIAQKAMALPSSGEGLAFFTFPNIDSPTKFKQLYRARMNTLEMTPEVKHRVTEEAKTAFLLNIELFEELQVMLTEEHKDQSPSQMASLRQRPASLVQDTAPAETPRGKPQISTSSSQTPLLQWVLTLSFLLATVAVGIYAM

Molecular Formula

15368 (Gene_ID) P14901 (M1-M289) (Accession)

Molecular Weight

Approximately 31 KDa & 34 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Azido 2-Acetamido-2-deoxy-3,4,6-tri-O-acetyl-β-D-glucopyranoside
GC8183-10g 10 g

Azido 2-Acetamido-2-deoxy-3,4,6-tri-O-acetyl-β-D-glucopyranoside

Sign In for Pricing
View Details
Varicella-Zoster Virus (VZV) (HRP)
MBS6125744-01 0.1 mL

Varicella-Zoster Virus (VZV) (HRP)

Sign In for Pricing
View Details
Varicella-Zoster Virus (VZV) (HRP)
MBS6125744-02 5x 0.1 mL

Varicella-Zoster Virus (VZV) (HRP)

Sign In for Pricing
View Details
AP-3 complex subunit mu-1 (AP3M1) Human ELISA Kit
B5919 96 Tests

AP-3 complex subunit mu-1 (AP3M1) Human ELISA Kit

Sign In for Pricing
View Details
Chromogenic Cronobacter Isolation Agar
RDM-CCI-01 500 g

Chromogenic Cronobacter Isolation Agar

Sign In for Pricing
View Details
Recombinant Human GMPR/ GMPR1 Protein, His-SUMO, E.coli-50ug
QP7200-ec-50ug 50ug

Recombinant Human GMPR/ GMPR1 Protein, His-SUMO, E.coli-50ug

Sign In for Pricing
View Details