Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HO-1, Mouse (P. pastoris, His)

HO-1 Protein catalyzes the oxidative cleavage of heme, releasing carbon monoxide (CO) and ferrous iron. It provides protection against programmed cell death by catabolizing free heme, preventing apoptosis sensitization. HO-1 Protein, Mouse (P. pastoris, His) is the recombinant mouse-derived HO-1 protein, expressed by P. pastoris , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

HO-1 Protein, Mouse (P. pastoris, His), Mouse, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fetal-tau-0n3r-protein-human-his.html

Purity

91

Smiles

MERPQPDSMPQDLSEALKEATKEVHIQAENAEFMKNFQKGQVSREGFKLVMASLYHIYTALEEEIERNKQNPVYAPLYFPEELHRRAALEQDMAFWYGPHWQEIIPCTPATQHYVKRLHEVGRTHPELLVAHAYTRYLGDLSGGQVLKKIAQKAMALPSSGEGLAFFTFPNIDSPTKFKQLYRARMNTLEMTPEVKHRVTEEAKTAFLLNIELFEELQVMLTEEHKDQSPSQMASLRQRPASLVQDTAPAETPRGKPQISTSSSQTPLLQWVLTLSFLLATVAVGIYAM

Molecular Formula

15368 (Gene_ID) P14901 (M1-M289) (Accession)

Molecular Weight

Approximately 31 KDa & 34 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

IL9 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K1077505 3x 1.0 µg

IL9 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Antiplasmin, Inhibitory
MBS607521-01 1 mg

Antiplasmin, Inhibitory

Sign In for Pricing
View Details
Antiplasmin, Inhibitory
MBS607521-02 5x 1 mg

Antiplasmin, Inhibitory

Sign In for Pricing
View Details
PAQR3, CT (PAQR3, Progestin and adipoQ receptor family member 3, Progestin and adipoQ receptor family member III, Raf kinase trapping to Golgi)
MBS6000717-01 0.2 mL

PAQR3, CT (PAQR3, Progestin and adipoQ receptor family member 3, Progestin and adipoQ receptor family member III, Raf kinase trapping to Golgi)

Sign In for Pricing
View Details
PAQR3, CT (PAQR3, Progestin and adipoQ receptor family member 3, Progestin and adipoQ receptor family member III, Raf kinase trapping to Golgi)
MBS6000717-02 5x 0.2 mL

PAQR3, CT (PAQR3, Progestin and adipoQ receptor family member 3, Progestin and adipoQ receptor family member III, Raf kinase trapping to Golgi)

Sign In for Pricing
View Details
HIF-1 alpha 556-574
M30232-01 100 mg

HIF-1 alpha 556-574

Sign In for Pricing
View Details