Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HO-1, Mouse (P. pastoris, His)

HO-1 Protein catalyzes the oxidative cleavage of heme, releasing carbon monoxide (CO) and ferrous iron. It provides protection against programmed cell death by catabolizing free heme, preventing apoptosis sensitization. HO-1 Protein, Mouse (P. pastoris, His) is the recombinant mouse-derived HO-1 protein, expressed by P. pastoris , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

HO-1 Protein, Mouse (P. pastoris, His), Mouse, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fetal-tau-0n3r-protein-human-his.html

Purity

91

Smiles

MERPQPDSMPQDLSEALKEATKEVHIQAENAEFMKNFQKGQVSREGFKLVMASLYHIYTALEEEIERNKQNPVYAPLYFPEELHRRAALEQDMAFWYGPHWQEIIPCTPATQHYVKRLHEVGRTHPELLVAHAYTRYLGDLSGGQVLKKIAQKAMALPSSGEGLAFFTFPNIDSPTKFKQLYRARMNTLEMTPEVKHRVTEEAKTAFLLNIELFEELQVMLTEEHKDQSPSQMASLRQRPASLVQDTAPAETPRGKPQISTSSSQTPLLQWVLTLSFLLATVAVGIYAM

Molecular Formula

15368 (Gene_ID) P14901 (M1-M289) (Accession)

Molecular Weight

Approximately 31 KDa & 34 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hif3a Rat shRNA Plasmid (Locus ID 64345)
TL710725 1 Kit

Hif3a Rat shRNA Plasmid (Locus ID 64345)

Sign In for Pricing
View Details
ZNF91, CT (Zinc finger protein 91, ZNF91, ) (AP) discontinued
044394-AP 200 µL

ZNF91, CT (Zinc finger protein 91, ZNF91, ) (AP) discontinued

Sign In for Pricing
View Details
Mouse Protocadherin-20, Pcdh20 ELISA KIT
ELI-45080m 96 Tests

Mouse Protocadherin-20, Pcdh20 ELISA KIT

Sign In for Pricing
View Details
ZNF124 (Zinc Finger Protein 124, Zinc Finger Protein HZF-16, HZF16, ZK7) (MaxLight 490)
MBS6399003-01 0.1 mL

ZNF124 (Zinc Finger Protein 124, Zinc Finger Protein HZF-16, HZF16, ZK7) (MaxLight 490)

Sign In for Pricing
View Details
ZNF124 (Zinc Finger Protein 124, Zinc Finger Protein HZF-16, HZF16, ZK7) (MaxLight 490)
MBS6399003-02 5x 0.1 mL

ZNF124 (Zinc Finger Protein 124, Zinc Finger Protein HZF-16, HZF16, ZK7) (MaxLight 490)

Sign In for Pricing
View Details
Rpl18 Mouse qPCR Template Standard (NM_009077)
MK201964 1 Kit

Rpl18 Mouse qPCR Template Standard (NM_009077)

Sign In for Pricing
View Details