Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HO-1, Mouse (P. pastoris, His)

HO-1 Protein catalyzes the oxidative cleavage of heme, releasing carbon monoxide (CO) and ferrous iron. It provides protection against programmed cell death by catabolizing free heme, preventing apoptosis sensitization. HO-1 Protein, Mouse (P. pastoris, His) is the recombinant mouse-derived HO-1 protein, expressed by P. pastoris , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

HO-1 Protein, Mouse (P. pastoris, His), Mouse, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fetal-tau-0n3r-protein-human-his.html

Purity

91

Smiles

MERPQPDSMPQDLSEALKEATKEVHIQAENAEFMKNFQKGQVSREGFKLVMASLYHIYTALEEEIERNKQNPVYAPLYFPEELHRRAALEQDMAFWYGPHWQEIIPCTPATQHYVKRLHEVGRTHPELLVAHAYTRYLGDLSGGQVLKKIAQKAMALPSSGEGLAFFTFPNIDSPTKFKQLYRARMNTLEMTPEVKHRVTEEAKTAFLLNIELFEELQVMLTEEHKDQSPSQMASLRQRPASLVQDTAPAETPRGKPQISTSSSQTPLLQWVLTLSFLLATVAVGIYAM

Molecular Formula

15368 (Gene_ID) P14901 (M1-M289) (Accession)

Molecular Weight

Approximately 31 KDa & 34 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olr1352 Recombinant Protein (Rat)
RP215903 100 µg

Olr1352 Recombinant Protein (Rat)

Sign In for Pricing
View Details
4-Amino-3-(4-fluorophenyl)butanoic Acid Hydrochloride
TRC-A608650-50MG 50 mg

4-Amino-3-(4-fluorophenyl)butanoic Acid Hydrochloride

Sign In for Pricing
View Details
FOXM1 Polyclonal Antibody
E55A01895 100 µg

FOXM1 Polyclonal Antibody

Sign In for Pricing
View Details
Sec22c (NM_178677) Mouse Tagged ORF Clone Lentiviral Particle
MR215723L3V 200 µL

Sec22c (NM_178677) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Recombinant Staphylococcus aureus Probable branched-chain-amino-acid aminotransferase (ilvE)
MBS1445648-01 0.02 mg (E-Coli)

Recombinant Staphylococcus aureus Probable branched-chain-amino-acid aminotransferase (ilvE)

Sign In for Pricing
View Details
Recombinant Staphylococcus aureus Probable branched-chain-amino-acid aminotransferase (ilvE)
MBS1445648-02 0.02 mg (Yeast)

Recombinant Staphylococcus aureus Probable branched-chain-amino-acid aminotransferase (ilvE)

Sign In for Pricing
View Details