Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HO-1, Mouse (P. pastoris, His)

HO-1 Protein catalyzes the oxidative cleavage of heme, releasing carbon monoxide (CO) and ferrous iron. It provides protection against programmed cell death by catabolizing free heme, preventing apoptosis sensitization. HO-1 Protein, Mouse (P. pastoris, His) is the recombinant mouse-derived HO-1 protein, expressed by P. pastoris , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

HO-1 Protein, Mouse (P. pastoris, His), Mouse, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fetal-tau-0n3r-protein-human-his.html

Purity

91

Smiles

MERPQPDSMPQDLSEALKEATKEVHIQAENAEFMKNFQKGQVSREGFKLVMASLYHIYTALEEEIERNKQNPVYAPLYFPEELHRRAALEQDMAFWYGPHWQEIIPCTPATQHYVKRLHEVGRTHPELLVAHAYTRYLGDLSGGQVLKKIAQKAMALPSSGEGLAFFTFPNIDSPTKFKQLYRARMNTLEMTPEVKHRVTEEAKTAFLLNIELFEELQVMLTEEHKDQSPSQMASLRQRPASLVQDTAPAETPRGKPQISTSSSQTPLLQWVLTLSFLLATVAVGIYAM

Molecular Formula

15368 (Gene_ID) P14901 (M1-M289) (Accession)

Molecular Weight

Approximately 31 KDa & 34 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

WBP11P1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
50274111 3x 1.0 µg

WBP11P1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
SLC16A4 Protein Vector (Human) (pPM-C-HA)
PV038279 500 ng

SLC16A4 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
FOXA2 Mouse Monoclonal Antibody [Clone ID: LBI3C10]
AMM08958V 100 µL

FOXA2 Mouse Monoclonal Antibody [Clone ID: LBI3C10]

Sign In for Pricing
View Details
RELB antibody
20R-1128 100 ug

RELB antibody

Sign In for Pricing
View Details
RIBC1 Blocking Peptide
33R-1393 100 ug

RIBC1 Blocking Peptide

Sign In for Pricing
View Details
Rabbit Anti-Human KLHDC2 pAb
PA8773-01 50 μL

Rabbit Anti-Human KLHDC2 pAb

Sign In for Pricing
View Details