Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HO-1, Mouse (P. pastoris, His)

HO-1 Protein catalyzes the oxidative cleavage of heme, releasing carbon monoxide (CO) and ferrous iron. It provides protection against programmed cell death by catabolizing free heme, preventing apoptosis sensitization. HO-1 Protein, Mouse (P. pastoris, His) is the recombinant mouse-derived HO-1 protein, expressed by P. pastoris , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

HO-1 Protein, Mouse (P. pastoris, His), Mouse, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fetal-tau-0n3r-protein-human-his.html

Purity

91

Smiles

MERPQPDSMPQDLSEALKEATKEVHIQAENAEFMKNFQKGQVSREGFKLVMASLYHIYTALEEEIERNKQNPVYAPLYFPEELHRRAALEQDMAFWYGPHWQEIIPCTPATQHYVKRLHEVGRTHPELLVAHAYTRYLGDLSGGQVLKKIAQKAMALPSSGEGLAFFTFPNIDSPTKFKQLYRARMNTLEMTPEVKHRVTEEAKTAFLLNIELFEELQVMLTEEHKDQSPSQMASLRQRPASLVQDTAPAETPRGKPQISTSSSQTPLLQWVLTLSFLLATVAVGIYAM

Molecular Formula

15368 (Gene_ID) P14901 (M1-M289) (Accession)

Molecular Weight

Approximately 31 KDa & 34 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hist1h2ag sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)
K3186106 1.0 µg DNA

Hist1h2ag sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
Osteopontin (SPP1) Mouse Monoclonal Antibody [Clone ID: LBI2F2]
AMM17452VCF 100 µg

Osteopontin (SPP1) Mouse Monoclonal Antibody [Clone ID: LBI2F2]

Sign In for Pricing
View Details
LST1 (NM_205839) Human Tagged ORF Clone
RC213326 10 µg

LST1 (NM_205839) Human Tagged ORF Clone

Sign In for Pricing
View Details
Cbx8 Rat shRNA Plasmid (Locus ID 303731)
TR703282 1 Kit

Cbx8 Rat shRNA Plasmid (Locus ID 303731)

Sign In for Pricing
View Details
Crotonoside discontinued
371319 5 mg

Crotonoside discontinued

Sign In for Pricing
View Details
Anti-B, monoclonal
B05301B 1x 5 L

Anti-B, monoclonal

Sign In for Pricing
View Details