Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TSLP R, Mouse (HEK293, His)

Cytokine receptor-like factor 2 (Crlf2), also known as thymic stromal lymphopoietin (TSLP) receptor, is a receptor for TSLP. Crlf2 can forms a functional complex with TSLP and IL7RA, and overexpression of Crlf2 stimulates cell proliferation through activation of the JAK-STAT pathway. The expression of Crlf2 usually upregulates and mutated in populations of B-progenitor acute lymphoblastic leukemia (B-ALL) [1][2]. TSLP R Protein, Mouse (HEK293, His) is the recombinant mouse-derived TSLP R protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

TSLP R Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tslpr-protein-mouse-hek-293-his.html

Purity

95.0

Smiles

AAAVTSRGDVTVVCHDLETVEVTWGSGPDHHSANLSLEFRYGTGALQPCPRYFLSGAGVTSGCILPAARAGLLELALRDGGGAMVFKARQRASAWLKPRPPWNVTLLWTPDGDVTVSWPAHSYLGLDYEVQHRESNDDEDAWQTTSGPCCDLTVGGLDPARCYDFRVRASPRAAHYGLEAQPSEWTAVTRLSGAASAASCTASPAPSPALAPPL

Molecular Formula

57914 (Gene_ID) AAH23788.1 (A20-L233) (Accession)

Molecular Weight

35-40 kDa

References & Citations

[1]Roll JD, Reuther GW. CRLF2 and JAK2 in B-progenitor acute lymphoblastic leukemia: a novel association in oncogenesis. Cancer Res. 2010 Oct 1;70 (19) :7347-52.|[2]Russell LJ, et al. Deregulated expression of cytokine receptor gene, CRLF2, is involved in lymphoid transformation in B-cell precursor acute lymphoblastic leukemia. Blood. 2009 Sep 24;114 (13) :2688-98.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fcrl1 (BC055830) Mouse Untagged Clone
MC218606 10 µg

Fcrl1 (BC055830) Mouse Untagged Clone

Sign In for Pricing
View Details
KSR, NT (Kinase Suppressor of Ras 1, KSR1, RSU2) (Biotin)
MBS6484560-01 0.2 mL

KSR, NT (Kinase Suppressor of Ras 1, KSR1, RSU2) (Biotin)

Sign In for Pricing
View Details
KSR, NT (Kinase Suppressor of Ras 1, KSR1, RSU2) (Biotin)
MBS6484560-02 5x 0.2 mL

KSR, NT (Kinase Suppressor of Ras 1, KSR1, RSU2) (Biotin)

Sign In for Pricing
View Details
MYRIP, CT (MYRIP, SLAC2C, Rab effector MyRIP, Exophilin-8, Myosin-VIIa-and Rab-interacting protein, Synaptotagmin-like protein lacking C2 domains C) (MaxLight 650)
MBS6323569-01 0.1 mL

MYRIP, CT (MYRIP, SLAC2C, Rab effector MyRIP, Exophilin-8, Myosin-VIIa-and Rab-interacting protein, Synaptotagmin-like protein lacking C2 domains C) (MaxLight 650)

Sign In for Pricing
View Details
MYRIP, CT (MYRIP, SLAC2C, Rab effector MyRIP, Exophilin-8, Myosin-VIIa-and Rab-interacting protein, Synaptotagmin-like protein lacking C2 domains C) (MaxLight 650)
MBS6323569-02 5x 0.1 mL

MYRIP, CT (MYRIP, SLAC2C, Rab effector MyRIP, Exophilin-8, Myosin-VIIa-and Rab-interacting protein, Synaptotagmin-like protein lacking C2 domains C) (MaxLight 650)

Sign In for Pricing
View Details
Tyrosine-protein Kinase Yes (YES1) Chicken ELISA Kit
H9786 96 Tests

Tyrosine-protein Kinase Yes (YES1) Chicken ELISA Kit

Sign In for Pricing
View Details