Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TSLP R, Mouse (HEK293, His)

Cytokine receptor-like factor 2 (Crlf2), also known as thymic stromal lymphopoietin (TSLP) receptor, is a receptor for TSLP. Crlf2 can forms a functional complex with TSLP and IL7RA, and overexpression of Crlf2 stimulates cell proliferation through activation of the JAK-STAT pathway. The expression of Crlf2 usually upregulates and mutated in populations of B-progenitor acute lymphoblastic leukemia (B-ALL) [1][2]. TSLP R Protein, Mouse (HEK293, His) is the recombinant mouse-derived TSLP R protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

TSLP R Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tslpr-protein-mouse-hek-293-his.html

Purity

95.0

Smiles

AAAVTSRGDVTVVCHDLETVEVTWGSGPDHHSANLSLEFRYGTGALQPCPRYFLSGAGVTSGCILPAARAGLLELALRDGGGAMVFKARQRASAWLKPRPPWNVTLLWTPDGDVTVSWPAHSYLGLDYEVQHRESNDDEDAWQTTSGPCCDLTVGGLDPARCYDFRVRASPRAAHYGLEAQPSEWTAVTRLSGAASAASCTASPAPSPALAPPL

Molecular Formula

57914 (Gene_ID) AAH23788.1 (A20-L233) (Accession)

Molecular Weight

35-40 kDa

References & Citations

[1]Roll JD, Reuther GW. CRLF2 and JAK2 in B-progenitor acute lymphoblastic leukemia: a novel association in oncogenesis. Cancer Res. 2010 Oct 1;70 (19) :7347-52.|[2]Russell LJ, et al. Deregulated expression of cytokine receptor gene, CRLF2, is involved in lymphoid transformation in B-cell precursor acute lymphoblastic leukemia. Blood. 2009 Sep 24;114 (13) :2688-98.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olfr109 Mouse shRNA Plasmid (Locus ID 258832)
TR510467 1 Kit

Olfr109 Mouse shRNA Plasmid (Locus ID 258832)

Sign In for Pricing
View Details
TXNL4B CRISPR All-in-one AAV vector set (with saCas9)(Human)
48883151 3x 1.0 µg DNA

TXNL4B CRISPR All-in-one AAV vector set (with saCas9)(Human)

Sign In for Pricing
View Details
PAX2 (Paired Box Protein Pax-2) (MaxLight 550)
130900-ML550 100 µL

PAX2 (Paired Box Protein Pax-2) (MaxLight 550)

Sign In for Pricing
View Details
UBP21 Rabbit Polyclonal Antibody
BT-AP13345-01 20 µL

UBP21 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
UBP21 Rabbit Polyclonal Antibody
BT-AP13345-02 50 µL

UBP21 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
UBP21 Rabbit Polyclonal Antibody
BT-AP13345-03 100 µL

UBP21 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details