Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TSLP R, Mouse (HEK293, His)

Cytokine receptor-like factor 2 (Crlf2), also known as thymic stromal lymphopoietin (TSLP) receptor, is a receptor for TSLP. Crlf2 can forms a functional complex with TSLP and IL7RA, and overexpression of Crlf2 stimulates cell proliferation through activation of the JAK-STAT pathway. The expression of Crlf2 usually upregulates and mutated in populations of B-progenitor acute lymphoblastic leukemia (B-ALL) [1][2]. TSLP R Protein, Mouse (HEK293, His) is the recombinant mouse-derived TSLP R protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

TSLP R Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tslpr-protein-mouse-hek-293-his.html

Purity

95.0

Smiles

AAAVTSRGDVTVVCHDLETVEVTWGSGPDHHSANLSLEFRYGTGALQPCPRYFLSGAGVTSGCILPAARAGLLELALRDGGGAMVFKARQRASAWLKPRPPWNVTLLWTPDGDVTVSWPAHSYLGLDYEVQHRESNDDEDAWQTTSGPCCDLTVGGLDPARCYDFRVRASPRAAHYGLEAQPSEWTAVTRLSGAASAASCTASPAPSPALAPPL

Molecular Formula

57914 (Gene_ID) AAH23788.1 (A20-L233) (Accession)

Molecular Weight

35-40 kDa

References & Citations

[1]Roll JD, Reuther GW. CRLF2 and JAK2 in B-progenitor acute lymphoblastic leukemia: a novel association in oncogenesis. Cancer Res. 2010 Oct 1;70 (19) :7347-52.|[2]Russell LJ, et al. Deregulated expression of cytokine receptor gene, CRLF2, is involved in lymphoid transformation in B-cell precursor acute lymphoblastic leukemia. Blood. 2009 Sep 24;114 (13) :2688-98.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

GRPEL2, NT (GRPEL2, GrpE protein homolog 2, mitochondrial, Mt-GrpE#2) (Biotin)
MBS6304538-01 0.2 mL

GRPEL2, NT (GRPEL2, GrpE protein homolog 2, mitochondrial, Mt-GrpE#2) (Biotin)

Sign In for Pricing
View Details
GRPEL2, NT (GRPEL2, GrpE protein homolog 2, mitochondrial, Mt-GrpE#2) (Biotin)
MBS6304538-02 5x 0.2 mL

GRPEL2, NT (GRPEL2, GrpE protein homolog 2, mitochondrial, Mt-GrpE#2) (Biotin)

Sign In for Pricing
View Details
SNORD115-11 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
44733111 3x 1.0 µg

SNORD115-11 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Zbtb43 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)
K4880008 1.0 µg DNA

Zbtb43 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
MIRacle™ mmu-miR-3154 miRNA Agomir/Antagomir
AM2761 2 OD, 4 OD, 50 OD

MIRacle™ mmu-miR-3154 miRNA Agomir/Antagomir

Sign In for Pricing
View Details
CDC42 binding protein kinase alpha (CDC42BPA) Rabbit Polyclonal Antibody
TA313011 100 µL

CDC42 binding protein kinase alpha (CDC42BPA) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details