Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD150/SLAMF1, Human (HEK293, His)

CD150/SLAMF1 Protein, Human (217a.a, HEK293, His) is a recombinant human CD150 expressed in HEK 293 cells with a His tag at the N-terminus. CD150 Protein acts as a cellular receptor for both vaccine and wild-type strains of measles virus (MV) [1][2].

Product Specifications

Product Name Alternative

CD150/SLAMF1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd150-protein-human-hek293-his.html

Purity

95.0

Smiles

ASYGTGGRMMNCPKILRQLGSKVLLPLTYERINKSMNKSIHIVVTMAKSLENSVENKIVSLDPSEAGPPRYLGDRYKFYLENLTLGIRESRKEDEGWYLMTLEKNVSVQRFCLQLRLYEQVSTPEIKVLNKTQENGTCTLILGCTVEKGDHVAYSWSEKAGTHPLNPANSSHLLSLTLGPQHADNIYICTVSNPISNNSQTFSPWPGCRTDPSETKPHHHHHH

Molecular Formula

6504 (Gene_ID) Q13291-1 (A21-P237) (Accession)

Molecular Weight

38-60 kDa

References & Citations

[1]Cannons JL, et, al. SLAM family receptors and SAP adaptors in immunity. Annu Rev Immunol. 2011;29:665-705.|[2]Hashimoto K, et, al. SLAM (CD150) -independent measles virus entry as revealed by recombinant virus expressing green fluorescent protein. J Virol. 2002 Jul;76 (13) :6743-9.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ABLIM2 (NM_001286688) Human Untagged Clone
SC335512 10 µg

ABLIM2 (NM_001286688) Human Untagged Clone

Sign In for Pricing
View Details
Ctrc (NM_001077649) Rat Untagged Clone
RN204900 10 µg

Ctrc (NM_001077649) Rat Untagged Clone

Sign In for Pricing
View Details
NIPAL4 3'UTR Luciferase Stable Cell Line
TU015696 1.0 mL

NIPAL4 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Neurofilament Heavy, phosphorylated (NF-200, NF200, NF-H, NEFH, N52, Neurofilament Heavy Polypeptide, Neurofilament Triplet H Protein, 200kD Neurofilament Protein, KIAA0845, NFH) (Not for Export EU)
215388 50 µL

Neurofilament Heavy, phosphorylated (NF-200, NF200, NF-H, NEFH, N52, Neurofilament Heavy Polypeptide, Neurofilament Triplet H Protein, 200kD Neurofilament Protein, KIAA0845, NFH) (Not for Export EU)

Sign In for Pricing
View Details
RXRA (NR2B1, Retinoic Acid Receptor RXR-alpha, Nuclear Receptor Subfamily 2 Group B Member 1, Retinoid X Receptor alpha, FLJ00280, FLJ00318, FLJ16020, FLJ16733, MGC102720) (MaxLight 405) discontinued
132904-ML405 100 µL

RXRA (NR2B1, Retinoic Acid Receptor RXR-alpha, Nuclear Receptor Subfamily 2 Group B Member 1, Retinoid X Receptor alpha, FLJ00280, FLJ00318, FLJ16020, FLJ16733, MGC102720) (MaxLight 405) discontinued

Sign In for Pricing
View Details
Rabbit Polyclonal Hepatitis C Virus Core Antigen Antibody [PerCP]
NB100-93581PCP 0.1 mL

Rabbit Polyclonal Hepatitis C Virus Core Antigen Antibody [PerCP]

Sign In for Pricing
View Details