Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD150/SLAMF1, Human (HEK293, His)

CD150/SLAMF1 Protein, Human (217a.a, HEK293, His) is a recombinant human CD150 expressed in HEK 293 cells with a His tag at the N-terminus. CD150 Protein acts as a cellular receptor for both vaccine and wild-type strains of measles virus (MV) [1][2].

Product Specifications

Product Name Alternative

CD150/SLAMF1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd150-protein-human-hek293-his.html

Purity

95.0

Smiles

ASYGTGGRMMNCPKILRQLGSKVLLPLTYERINKSMNKSIHIVVTMAKSLENSVENKIVSLDPSEAGPPRYLGDRYKFYLENLTLGIRESRKEDEGWYLMTLEKNVSVQRFCLQLRLYEQVSTPEIKVLNKTQENGTCTLILGCTVEKGDHVAYSWSEKAGTHPLNPANSSHLLSLTLGPQHADNIYICTVSNPISNNSQTFSPWPGCRTDPSETKPHHHHHH

Molecular Formula

6504 (Gene_ID) Q13291-1 (A21-P237) (Accession)

Molecular Weight

38-60 kDa

References & Citations

[1]Cannons JL, et, al. SLAM family receptors and SAP adaptors in immunity. Annu Rev Immunol. 2011;29:665-705.|[2]Hashimoto K, et, al. SLAM (CD150) -independent measles virus entry as revealed by recombinant virus expressing green fluorescent protein. J Virol. 2002 Jul;76 (13) :6743-9.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Vmn2r79 Mouse shRNA Plasmid (Locus ID 621430)
TL518627 1 Kit

Vmn2r79 Mouse shRNA Plasmid (Locus ID 621430)

Sign In for Pricing
View Details
Lentiviral human GALNT3 shRNA (UAS) - Lentiviral human GALNT3 shRNA (UAS, GFP) (100)
GTR15085545 1 Vial

Lentiviral human GALNT3 shRNA (UAS) - Lentiviral human GALNT3 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
Pik3c2g sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
K3649205 3x 1.0 µg

Pik3c2g sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
VPAC2 (VIPR2) Human qPCR Template Standard (NM_003382)
HK207876 1 Kit

VPAC2 (VIPR2) Human qPCR Template Standard (NM_003382)

Sign In for Pricing
View Details
SHFM3 Recombinant Protein Antigen
NBP2-14013PEP 0.1 mL

SHFM3 Recombinant Protein Antigen

Sign In for Pricing
View Details
Zscan12 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)
K4950708 1.0 µg DNA

Zscan12 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details