Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD150/SLAMF1, Human (HEK293, His)

CD150/SLAMF1 Protein, Human (217a.a, HEK293, His) is a recombinant human CD150 expressed in HEK 293 cells with a His tag at the N-terminus. CD150 Protein acts as a cellular receptor for both vaccine and wild-type strains of measles virus (MV) [1][2].

Product Specifications

Product Name Alternative

CD150/SLAMF1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd150-protein-human-hek293-his.html

Purity

95.0

Smiles

ASYGTGGRMMNCPKILRQLGSKVLLPLTYERINKSMNKSIHIVVTMAKSLENSVENKIVSLDPSEAGPPRYLGDRYKFYLENLTLGIRESRKEDEGWYLMTLEKNVSVQRFCLQLRLYEQVSTPEIKVLNKTQENGTCTLILGCTVEKGDHVAYSWSEKAGTHPLNPANSSHLLSLTLGPQHADNIYICTVSNPISNNSQTFSPWPGCRTDPSETKPHHHHHH

Molecular Formula

6504 (Gene_ID) Q13291-1 (A21-P237) (Accession)

Molecular Weight

38-60 kDa

References & Citations

[1]Cannons JL, et, al. SLAM family receptors and SAP adaptors in immunity. Annu Rev Immunol. 2011;29:665-705.|[2]Hashimoto K, et, al. SLAM (CD150) -independent measles virus entry as revealed by recombinant virus expressing green fluorescent protein. J Virol. 2002 Jul;76 (13) :6743-9.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

NOTCH4 Polyclonal Antibody, APC Conjugated
bs-7482R-APC 100 µL

NOTCH4 Polyclonal Antibody, APC Conjugated

Sign In for Pricing
View Details
Prl3b1 AAV siRNA Pooled Vector
37682166 1.0 µg

Prl3b1 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
PLXDC1 sgRNA CRISPR Lentivector (Human) (Target 1)
K1671402 1.0 µg DNA

PLXDC1 sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
HNRNPA1P30 Recombinant Protein (Human)
RP063129 100 µg

HNRNPA1P30 Recombinant Protein (Human)

Sign In for Pricing
View Details
CRIPT polyclonal antibody
BS75716-01 50 µL

CRIPT polyclonal antibody

Sign In for Pricing
View Details
CRIPT polyclonal antibody
BS75716-02 100 µL

CRIPT polyclonal antibody

Sign In for Pricing
View Details