Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD150/SLAMF1, Human (HEK293, His)

CD150/SLAMF1 Protein, Human (217a.a, HEK293, His) is a recombinant human CD150 expressed in HEK 293 cells with a His tag at the N-terminus. CD150 Protein acts as a cellular receptor for both vaccine and wild-type strains of measles virus (MV) [1][2].

Product Specifications

Product Name Alternative

CD150/SLAMF1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd150-protein-human-hek293-his.html

Purity

95.0

Smiles

ASYGTGGRMMNCPKILRQLGSKVLLPLTYERINKSMNKSIHIVVTMAKSLENSVENKIVSLDPSEAGPPRYLGDRYKFYLENLTLGIRESRKEDEGWYLMTLEKNVSVQRFCLQLRLYEQVSTPEIKVLNKTQENGTCTLILGCTVEKGDHVAYSWSEKAGTHPLNPANSSHLLSLTLGPQHADNIYICTVSNPISNNSQTFSPWPGCRTDPSETKPHHHHHH

Molecular Formula

6504 (Gene_ID) Q13291-1 (A21-P237) (Accession)

Molecular Weight

38-60 kDa

References & Citations

[1]Cannons JL, et, al. SLAM family receptors and SAP adaptors in immunity. Annu Rev Immunol. 2011;29:665-705.|[2]Hashimoto K, et, al. SLAM (CD150) -independent measles virus entry as revealed by recombinant virus expressing green fluorescent protein. J Virol. 2002 Jul;76 (13) :6743-9.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lamtor3 (NM_001008375) Rat Untagged Clone
RN211242 10 µg

Lamtor3 (NM_001008375) Rat Untagged Clone

Sign In for Pricing
View Details
Benzotropine Mesylate
TRC-B207575-50MG 50 mg

Benzotropine Mesylate

Sign In for Pricing
View Details
OR52A1 Recombinant Protein (Human)
RP080622 100 µg

OR52A1 Recombinant Protein (Human)

Sign In for Pricing
View Details
PDHX (NM_003477) Human Over-expression Lysate
LH06693V 100 µg

PDHX (NM_003477) Human Over-expression Lysate

Sign In for Pricing
View Details
CYB561D2 Protein Vector (Rat) (pPB-C-His)
PV262610 500 ng

CYB561D2 Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details
Anti Human Mphosph8 Pab
111645 100 µg

Anti Human Mphosph8 Pab

Sign In for Pricing
View Details