Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD150/SLAMF1, Human (HEK293, His)

CD150/SLAMF1 Protein, Human (217a.a, HEK293, His) is a recombinant human CD150 expressed in HEK 293 cells with a His tag at the N-terminus. CD150 Protein acts as a cellular receptor for both vaccine and wild-type strains of measles virus (MV) [1][2].

Product Specifications

Product Name Alternative

CD150/SLAMF1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd150-protein-human-hek293-his.html

Purity

95.0

Smiles

ASYGTGGRMMNCPKILRQLGSKVLLPLTYERINKSMNKSIHIVVTMAKSLENSVENKIVSLDPSEAGPPRYLGDRYKFYLENLTLGIRESRKEDEGWYLMTLEKNVSVQRFCLQLRLYEQVSTPEIKVLNKTQENGTCTLILGCTVEKGDHVAYSWSEKAGTHPLNPANSSHLLSLTLGPQHADNIYICTVSNPISNNSQTFSPWPGCRTDPSETKPHHHHHH

Molecular Formula

6504 (Gene_ID) Q13291-1 (A21-P237) (Accession)

Molecular Weight

38-60 kDa

References & Citations

[1]Cannons JL, et, al. SLAM family receptors and SAP adaptors in immunity. Annu Rev Immunol. 2011;29:665-705.|[2]Hashimoto K, et, al. SLAM (CD150) -independent measles virus entry as revealed by recombinant virus expressing green fluorescent protein. J Virol. 2002 Jul;76 (13) :6743-9.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Borrelia Garinii p58
32-5384-20 20 µg

Recombinant Borrelia Garinii p58

Sign In for Pricing
View Details
Glutamine Synthetase (GS) Assay Kit
E47S081 100 Tests - 48 Samples

Glutamine Synthetase (GS) Assay Kit

Sign In for Pricing
View Details
AOAH-IT1 Protein Vector (Human) (pPB-N-His)
PV062606 500 ng

AOAH-IT1 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
Superoxide Dismutase 1
SOD-002-01 100 µg

Superoxide Dismutase 1

Sign In for Pricing
View Details
Superoxide Dismutase 1
SOD-002-02 50 µg

Superoxide Dismutase 1

Sign In for Pricing
View Details
L1CAM Mouse Monoclonal Antibody [Clone ID: OTI2G5]
CF501442 100 µg

L1CAM Mouse Monoclonal Antibody [Clone ID: OTI2G5]

Sign In for Pricing
View Details