Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD150/SLAMF1, Human (HEK293, His)

CD150/SLAMF1 Protein, Human (217a.a, HEK293, His) is a recombinant human CD150 expressed in HEK 293 cells with a His tag at the N-terminus. CD150 Protein acts as a cellular receptor for both vaccine and wild-type strains of measles virus (MV) [1][2].

Product Specifications

Product Name Alternative

CD150/SLAMF1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd150-protein-human-hek293-his.html

Purity

95.0

Smiles

ASYGTGGRMMNCPKILRQLGSKVLLPLTYERINKSMNKSIHIVVTMAKSLENSVENKIVSLDPSEAGPPRYLGDRYKFYLENLTLGIRESRKEDEGWYLMTLEKNVSVQRFCLQLRLYEQVSTPEIKVLNKTQENGTCTLILGCTVEKGDHVAYSWSEKAGTHPLNPANSSHLLSLTLGPQHADNIYICTVSNPISNNSQTFSPWPGCRTDPSETKPHHHHHH

Molecular Formula

6504 (Gene_ID) Q13291-1 (A21-P237) (Accession)

Molecular Weight

38-60 kDa

References & Citations

[1]Cannons JL, et, al. SLAM family receptors and SAP adaptors in immunity. Annu Rev Immunol. 2011;29:665-705.|[2]Hashimoto K, et, al. SLAM (CD150) -independent measles virus entry as revealed by recombinant virus expressing green fluorescent protein. J Virol. 2002 Jul;76 (13) :6743-9.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

OR4D10 sgRNA CRISPR Lentivector (Human) (Target 2)
K1507703 1.0 µg DNA

OR4D10 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Mouse SPEG siRNA
abx934925-01 15 nmol

Mouse SPEG siRNA

Sign In for Pricing
View Details
Mouse SPEG siRNA
abx934925-02 30 nmol

Mouse SPEG siRNA

Sign In for Pricing
View Details
PADI3 Antibody, Biotin conjugated
A71394-100UG 100 µg

PADI3 Antibody, Biotin conjugated

Sign In for Pricing
View Details
RNF126P1 sgRNA CRISPR Lentivector set (Human)
K1837901 3x 1.0 µg

RNF126P1 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
Cathepsin D (CTSD) mouse monoclonal antibody, clone 4G2, Purified
AM09003PU-S 50 µL

Cathepsin D (CTSD) mouse monoclonal antibody, clone 4G2, Purified

Sign In for Pricing
View Details