Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD150/SLAMF1, Human (HEK293, His)

CD150/SLAMF1 Protein, Human (217a.a, HEK293, His) is a recombinant human CD150 expressed in HEK 293 cells with a His tag at the N-terminus. CD150 Protein acts as a cellular receptor for both vaccine and wild-type strains of measles virus (MV) [1][2].

Product Specifications

Product Name Alternative

CD150/SLAMF1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd150-protein-human-hek293-his.html

Purity

95.0

Smiles

ASYGTGGRMMNCPKILRQLGSKVLLPLTYERINKSMNKSIHIVVTMAKSLENSVENKIVSLDPSEAGPPRYLGDRYKFYLENLTLGIRESRKEDEGWYLMTLEKNVSVQRFCLQLRLYEQVSTPEIKVLNKTQENGTCTLILGCTVEKGDHVAYSWSEKAGTHPLNPANSSHLLSLTLGPQHADNIYICTVSNPISNNSQTFSPWPGCRTDPSETKPHHHHHH

Molecular Formula

6504 (Gene_ID) Q13291-1 (A21-P237) (Accession)

Molecular Weight

38-60 kDa

References & Citations

[1]Cannons JL, et, al. SLAM family receptors and SAP adaptors in immunity. Annu Rev Immunol. 2011;29:665-705.|[2]Hashimoto K, et, al. SLAM (CD150) -independent measles virus entry as revealed by recombinant virus expressing green fluorescent protein. J Virol. 2002 Jul;76 (13) :6743-9.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

D.C.L.S. HiVeg® Agar
MV160-100G 100 g

D.C.L.S. HiVeg® Agar

Sign In for Pricing
View Details
Rat G3bp1 Pre-designed siRNA Set A
SI205326A 1 Each

Rat G3bp1 Pre-designed siRNA Set A

Sign In for Pricing
View Details
Rabbit Polyclonal BAG5 Antibody
NBP2-84492-0.1mL 0.1 mL

Rabbit Polyclonal BAG5 Antibody

Sign In for Pricing
View Details
Recombinant Human ErbB2/Her2 Fc His Alexa Fluor 647 Protein
AFR1129-020 20 µg

Recombinant Human ErbB2/Her2 Fc His Alexa Fluor 647 Protein

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Ribonuclease T2 (RNASET2)
MBS2037953-01 0.1 mL

APC/CY7-Linked Polyclonal Antibody to Ribonuclease T2 (RNASET2)

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Ribonuclease T2 (RNASET2)
MBS2037953-02 0.2 mL

APC/CY7-Linked Polyclonal Antibody to Ribonuclease T2 (RNASET2)

Sign In for Pricing
View Details