Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD150/SLAMF1, Human (HEK293, His)

CD150/SLAMF1 Protein, Human (217a.a, HEK293, His) is a recombinant human CD150 expressed in HEK 293 cells with a His tag at the N-terminus. CD150 Protein acts as a cellular receptor for both vaccine and wild-type strains of measles virus (MV) [1][2].

Product Specifications

Product Name Alternative

CD150/SLAMF1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd150-protein-human-hek293-his.html

Purity

95.0

Smiles

ASYGTGGRMMNCPKILRQLGSKVLLPLTYERINKSMNKSIHIVVTMAKSLENSVENKIVSLDPSEAGPPRYLGDRYKFYLENLTLGIRESRKEDEGWYLMTLEKNVSVQRFCLQLRLYEQVSTPEIKVLNKTQENGTCTLILGCTVEKGDHVAYSWSEKAGTHPLNPANSSHLLSLTLGPQHADNIYICTVSNPISNNSQTFSPWPGCRTDPSETKPHHHHHH

Molecular Formula

6504 (Gene_ID) Q13291-1 (A21-P237) (Accession)

Molecular Weight

38-60 kDa

References & Citations

[1]Cannons JL, et, al. SLAM family receptors and SAP adaptors in immunity. Annu Rev Immunol. 2011;29:665-705.|[2]Hashimoto K, et, al. SLAM (CD150) -independent measles virus entry as revealed by recombinant virus expressing green fluorescent protein. J Virol. 2002 Jul;76 (13) :6743-9.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sodium phosphate buffer (NaPi), 0.1 M, pH 6.5, 1000  ml
12-9529-10 10 Pouches

Sodium phosphate buffer (NaPi), 0.1 M, pH 6.5, 1000 ml

Sign In for Pricing
View Details
Anti-NFKB1 antibody
STJ28750 100 µl

Anti-NFKB1 antibody

Sign In for Pricing
View Details
BM-1074 25mg
A12743-25 25 mg

BM-1074 25mg

Sign In for Pricing
View Details
IAA15 Antibody
PHY7895A 150 μg

IAA15 Antibody

Sign In for Pricing
View Details
Protein KIAA1731 (KIAA1731) Mouse ELISA Kit
G3449 96 Tests

Protein KIAA1731 (KIAA1731) Mouse ELISA Kit

Sign In for Pricing
View Details
Anti-PFKM antibody
STJ27430 100 µl

Anti-PFKM antibody

Sign In for Pricing
View Details