Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD150/SLAMF1, Human (HEK293, His)

CD150/SLAMF1 Protein, Human (217a.a, HEK293, His) is a recombinant human CD150 expressed in HEK 293 cells with a His tag at the N-terminus. CD150 Protein acts as a cellular receptor for both vaccine and wild-type strains of measles virus (MV) [1][2].

Product Specifications

Product Name Alternative

CD150/SLAMF1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd150-protein-human-hek293-his.html

Purity

95.0

Smiles

ASYGTGGRMMNCPKILRQLGSKVLLPLTYERINKSMNKSIHIVVTMAKSLENSVENKIVSLDPSEAGPPRYLGDRYKFYLENLTLGIRESRKEDEGWYLMTLEKNVSVQRFCLQLRLYEQVSTPEIKVLNKTQENGTCTLILGCTVEKGDHVAYSWSEKAGTHPLNPANSSHLLSLTLGPQHADNIYICTVSNPISNNSQTFSPWPGCRTDPSETKPHHHHHH

Molecular Formula

6504 (Gene_ID) Q13291-1 (A21-P237) (Accession)

Molecular Weight

38-60 kDa

References & Citations

[1]Cannons JL, et, al. SLAM family receptors and SAP adaptors in immunity. Annu Rev Immunol. 2011;29:665-705.|[2]Hashimoto K, et, al. SLAM (CD150) -independent measles virus entry as revealed by recombinant virus expressing green fluorescent protein. J Virol. 2002 Jul;76 (13) :6743-9.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

GAS8 (Growth Arrest-specific Protein 8, GAS11)
316867-01 50 µL

GAS8 (Growth Arrest-specific Protein 8, GAS11)

Sign In for Pricing
View Details
GAS8 (Growth Arrest-specific Protein 8, GAS11)
316867-02 100 µL

GAS8 (Growth Arrest-specific Protein 8, GAS11)

Sign In for Pricing
View Details
Lentiviral mouse Kansl1l shRNA (UAS) - Lentiviral mouse Kansl1l shRNA (UAS, RFP) plasmid
GTR15280693 1 Vial

Lentiviral mouse Kansl1l shRNA (UAS) - Lentiviral mouse Kansl1l shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
Kcnn4 (NM_001163510) Mouse Tagged ORF Clone
MG226841 10 µg

Kcnn4 (NM_001163510) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Recombinant Human CCL15/MIP-1delta Protein (Trx Tag)
MBS2580286-01 0.02 mg

Recombinant Human CCL15/MIP-1delta Protein (Trx Tag)

Sign In for Pricing
View Details
Recombinant Human CCL15/MIP-1delta Protein (Trx Tag)
MBS2580286-02 0.1 mg

Recombinant Human CCL15/MIP-1delta Protein (Trx Tag)

Sign In for Pricing
View Details