Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD150/SLAMF1, Human (HEK293, His)

CD150/SLAMF1 Protein, Human (217a.a, HEK293, His) is a recombinant human CD150 expressed in HEK 293 cells with a His tag at the N-terminus. CD150 Protein acts as a cellular receptor for both vaccine and wild-type strains of measles virus (MV) [1][2].

Product Specifications

Product Name Alternative

CD150/SLAMF1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd150-protein-human-hek293-his.html

Purity

95.0

Smiles

ASYGTGGRMMNCPKILRQLGSKVLLPLTYERINKSMNKSIHIVVTMAKSLENSVENKIVSLDPSEAGPPRYLGDRYKFYLENLTLGIRESRKEDEGWYLMTLEKNVSVQRFCLQLRLYEQVSTPEIKVLNKTQENGTCTLILGCTVEKGDHVAYSWSEKAGTHPLNPANSSHLLSLTLGPQHADNIYICTVSNPISNNSQTFSPWPGCRTDPSETKPHHHHHH

Molecular Formula

6504 (Gene_ID) Q13291-1 (A21-P237) (Accession)

Molecular Weight

38-60 kDa

References & Citations

[1]Cannons JL, et, al. SLAM family receptors and SAP adaptors in immunity. Annu Rev Immunol. 2011;29:665-705.|[2]Hashimoto K, et, al. SLAM (CD150) -independent measles virus entry as revealed by recombinant virus expressing green fluorescent protein. J Virol. 2002 Jul;76 (13) :6743-9.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

COP9 Signalosome complex subunit 7b (COPS7B) Bovine ELISA Kit
C5773 96 Tests

COP9 Signalosome complex subunit 7b (COPS7B) Bovine ELISA Kit

Sign In for Pricing
View Details
Compound N032-0002
MBS5796239 Inquire

Compound N032-0002

Sign In for Pricing
View Details
SLAMF1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV715060 1.0 µg DNA

SLAMF1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details
CWF19L1 (NM_001303405) Human Untagged Clone
SC335882 10 µg

CWF19L1 (NM_001303405) Human Untagged Clone

Sign In for Pricing
View Details
H4C5 Human Gene Knockout Kit (CRISPR)
KN403097 1 Kit

H4C5 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Hepatitis C Virus Genotype 1a Envelope Glycoprotein E2 (HCV-1a E2) Antibody
abx201331-01 100 µL

Hepatitis C Virus Genotype 1a Envelope Glycoprotein E2 (HCV-1a E2) Antibody

Sign In for Pricing
View Details