Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD150/SLAMF1, Human (HEK293, His)

CD150/SLAMF1 Protein, Human (217a.a, HEK293, His) is a recombinant human CD150 expressed in HEK 293 cells with a His tag at the N-terminus. CD150 Protein acts as a cellular receptor for both vaccine and wild-type strains of measles virus (MV) [1][2].

Product Specifications

Product Name Alternative

CD150/SLAMF1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd150-protein-human-hek293-his.html

Purity

95.0

Smiles

ASYGTGGRMMNCPKILRQLGSKVLLPLTYERINKSMNKSIHIVVTMAKSLENSVENKIVSLDPSEAGPPRYLGDRYKFYLENLTLGIRESRKEDEGWYLMTLEKNVSVQRFCLQLRLYEQVSTPEIKVLNKTQENGTCTLILGCTVEKGDHVAYSWSEKAGTHPLNPANSSHLLSLTLGPQHADNIYICTVSNPISNNSQTFSPWPGCRTDPSETKPHHHHHH

Molecular Formula

6504 (Gene_ID) Q13291-1 (A21-P237) (Accession)

Molecular Weight

38-60 kDa

References & Citations

[1]Cannons JL, et, al. SLAM family receptors and SAP adaptors in immunity. Annu Rev Immunol. 2011;29:665-705.|[2]Hashimoto K, et, al. SLAM (CD150) -independent measles virus entry as revealed by recombinant virus expressing green fluorescent protein. J Virol. 2002 Jul;76 (13) :6743-9.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

1500009L16Rik sgRNA CRISPR Lentivector (Mouse) (Target 3)
K4850004 1.0 µg DNA

1500009L16Rik sgRNA CRISPR Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
Olfr392 (NM_147006) Mouse Tagged Lenti ORF Clone
MR213931L3 10 µg

Olfr392 (NM_147006) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
ZMAT1 Protein Vector (Mouse) (pPM-C-HA)
51266024 500 ng

ZMAT1 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Alpha-galactosidase A Antibody
E51A05735 100 µL

Alpha-galactosidase A Antibody

Sign In for Pricing
View Details
Lentiviral human HTR3C sgRNA gene knockout kit - Lentiviral human HTR3C sgRNA gene knockout kit (100)
GTR15383407 1 Vial

Lentiviral human HTR3C sgRNA gene knockout kit - Lentiviral human HTR3C sgRNA gene knockout kit (100)

Sign In for Pricing
View Details
anti-Frataxin
YF-PA11851 50 ug

anti-Frataxin

Sign In for Pricing
View Details