Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD150/SLAMF1, Human (HEK293, His)

CD150/SLAMF1 Protein, Human (217a.a, HEK293, His) is a recombinant human CD150 expressed in HEK 293 cells with a His tag at the N-terminus. CD150 Protein acts as a cellular receptor for both vaccine and wild-type strains of measles virus (MV) [1][2].

Product Specifications

Product Name Alternative

CD150/SLAMF1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd150-protein-human-hek293-his.html

Purity

95.0

Smiles

ASYGTGGRMMNCPKILRQLGSKVLLPLTYERINKSMNKSIHIVVTMAKSLENSVENKIVSLDPSEAGPPRYLGDRYKFYLENLTLGIRESRKEDEGWYLMTLEKNVSVQRFCLQLRLYEQVSTPEIKVLNKTQENGTCTLILGCTVEKGDHVAYSWSEKAGTHPLNPANSSHLLSLTLGPQHADNIYICTVSNPISNNSQTFSPWPGCRTDPSETKPHHHHHH

Molecular Formula

6504 (Gene_ID) Q13291-1 (A21-P237) (Accession)

Molecular Weight

38-60 kDa

References & Citations

[1]Cannons JL, et, al. SLAM family receptors and SAP adaptors in immunity. Annu Rev Immunol. 2011;29:665-705.|[2]Hashimoto K, et, al. SLAM (CD150) -independent measles virus entry as revealed by recombinant virus expressing green fluorescent protein. J Virol. 2002 Jul;76 (13) :6743-9.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ECHDC3 (Enoyl-CoA Hydratase Domain-Containing Protein 3, Mitochondrial, ECHDC3) (AP)
MBS6455689-01 0.2 mL

ECHDC3 (Enoyl-CoA Hydratase Domain-Containing Protein 3, Mitochondrial, ECHDC3) (AP)

Sign In for Pricing
View Details
ECHDC3 (Enoyl-CoA Hydratase Domain-Containing Protein 3, Mitochondrial, ECHDC3) (AP)
MBS6455689-02 5x 0.2 mL

ECHDC3 (Enoyl-CoA Hydratase Domain-Containing Protein 3, Mitochondrial, ECHDC3) (AP)

Sign In for Pricing
View Details
MDM2 (NM_001278462) Human Tagged ORF Clone
RG237428 10 µg

MDM2 (NM_001278462) Human Tagged ORF Clone

Sign In for Pricing
View Details
Mouse Nicotinamide Adenine Dinucleotide Phosphate Oxidase Gp91Phox ELISA Kit
MBS021854-01 48 Well

Mouse Nicotinamide Adenine Dinucleotide Phosphate Oxidase Gp91Phox ELISA Kit

Sign In for Pricing
View Details
Mouse Nicotinamide Adenine Dinucleotide Phosphate Oxidase Gp91Phox ELISA Kit
MBS021854-02 96 Well

Mouse Nicotinamide Adenine Dinucleotide Phosphate Oxidase Gp91Phox ELISA Kit

Sign In for Pricing
View Details
Mouse Nicotinamide Adenine Dinucleotide Phosphate Oxidase Gp91Phox ELISA Kit
MBS021854-03 5x 96 Well

Mouse Nicotinamide Adenine Dinucleotide Phosphate Oxidase Gp91Phox ELISA Kit

Sign In for Pricing
View Details