GH/Somatotropin, Human (CHO)
GH Protein, Human (CHO) is a peptide hormone that stimulates growth, cell reproduction, and cell regeneration, which can be used for the treatment of growth disorders in children.
Product Specifications
Product Name Alternative
GH/Somatotropin Protein, Human (CHO), Human, CHO
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/gh-protein-human-cho.html
Purity
96.00
Smiles
FPTIPLSRLFDNASLRAHRLHQLAFDTYQEFEEAYIPKEQKYSFLQNPQTSLCFSESIPTPSNREETQQKSNLELLRISLLLIQSWLEPVQFLRSVFANSLVYGASDSNVYDLLKDLEEGIQTLMGRLEDGSPRTGQIFKQTYSKFDTNSHNDDALLKNYGLLYCFRKDMDKVETFLRIVQCRSVEGSCGF
Molecular Formula
2688 (Gene_ID) CAA23779.1 (F27-F217) (Accession)
Molecular Weight
Approximately 20-24 kDa.
References & Citations
[1]Takeda A, et al. Recombinant human growth hormone for the treatment of growth disorders in children: a systematic review and economic evaluation. Health Technol Assess. 2010 Sep;14 (42) :1-209, iii-iv.|[2]Ranabir S, et al. Stress and hormones. Indian J Endocrinol Metab. 2011 Jan;15 (1) :18-22.|[3]Binder G, et al. "Noonan Syndrome: Genetics and Responsiveness to Growth Hormone Therapy". Horm Res. 67 (Supplement 1) : 45-49.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
SYP-H0593-01 48 Well
Human MMP-10(Matrix Metalloproteinase 10) ELISA Kit
Sign In for Pricing
View Details SYP-H0593-02 96 Well
Human MMP-10(Matrix Metalloproteinase 10) ELISA Kit
Sign In for Pricing
View Details