Complement factor H/CFH, Human (372a.a, HEK293, His)
Complement factor H/CFH proteins regulate complement activation and act as soluble inhibitors to prevent complement amplification on the cell surface. Complement factor H/CFH Protein, Human (372a.a, HEK293, His) is the recombinant human-derived Complement factor H/CFH protein, expressed by HEK293 , with C-His labeled tag.
Product Specifications
Product Name Alternative
Complement factor H/CFH Protein, Human (372a.a, HEK293, His), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/complement-factor-h-cfh-protein-human-hek293-his.html
Purity
96.10
Smiles
SIPLCVEKIPCSQPPQIEHGTINSSRSSQESYAHGTKLSYTCEGGFRISEENETTCYMGKWSSPPQCEGLPCKSPPEISHGVVAHMSDSYQYGEEVTYKCFEGFGIDGPAIAKCLGEKWSHPPSCIKTDCLSLPSFENAIPMGEKKDVYKAGEQVTYTCATYYKMDGASNVTCINSRWTGRPTCRDTSCVNPPTVQNAYIVSRQMSKYPSGERVRYQCRSPYEMFGDEEVMCLNGNWTEPPQCKDSTGKCGPPPPIDNGDITSFPLSVYAPASSVEYQCQNLYQLEGNKRITCRNGQWSEPPKCLHPCVISREIMENYNIALRWTAKQKLYSRTGESVEFVCKRGYRLSSRSHTLRTTCWDGKLEYPTCAKR
Molecular Formula
3075 (Gene_ID) P08603-1 (S860-R1231) (Accession)
Molecular Weight
55-60 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS2058129-01 0.1 mL
HRP-Linked Polyclonal Antibody to Defensin Alpha 1, Neutrophil (DEFa1)
Sign In for Pricing
View Details MBS2058129-02 0.2 mL
HRP-Linked Polyclonal Antibody to Defensin Alpha 1, Neutrophil (DEFa1)
Sign In for Pricing
View Details MBS2058129-03 0.5 mL
HRP-Linked Polyclonal Antibody to Defensin Alpha 1, Neutrophil (DEFa1)
Sign In for Pricing
View Details MBS2058129-04 1 mL
HRP-Linked Polyclonal Antibody to Defensin Alpha 1, Neutrophil (DEFa1)
Sign In for Pricing
View Details