IGSF11, Human (HEK293, Fc)
Selected Variant
HY-P70854-01
Size: 10 µg
IGSF11 Protein functions as a cell adhesion molecule, facilitating cellular adhesion through homophilic interactions. It also stimulates cell growth, suggesting its role in regulating cellular proliferation. IGSF11 Protein, Human (HEK293, Fc) is the recombinant human-derived IGSF11 protein, expressed by HEK293 , with C-hFc labeled tag.
Product Specifications
Product Name Alternative
IGSF11 Protein, Human (HEK293, Fc), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/igsf11-protein-human-hek-293-fc.html
Purity
95.00
Smiles
LEVSESPGSIQVARGQPAVLPCTFTTSAALINLNVIWMVTPLSNANQPEQVILYQGGQMFDGAPRFHGRVGFTGTMPATNVSIFINNTQLSDTGTYQCLVNNLPDIGGRNIGVTGLTVLVPPSAPHCQIQGSQDIGSDVILLCSSEEGIPRPTYLWEKLDNTLKLPPTATQDQVQGTVTIRNISALSSGLYQCVASNAIGTSTCLLDLQVISPQPRNIGLIAG
Molecular Formula
152404 (Gene_ID) Q5DX21-1 (L23-G245) (Accession)
Molecular Weight
57-70 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Price
Sign In for Pricing
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNCB1975-100 1x 100 µL
CD45 / LCA (B-Cell Marker) (PTPRC/1975R), Biotin conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNUB1879-500 1x 500 µL
Bcl-2 (Apoptosis & Follicular Lymphoma Marker) (rBCL2/796), 0.2mg/mL
Sign In for Pricing
View Details 
BNC681133-100 1x 100 µL
CD74 (CLIP/1133), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC742303-500 1x 500 µL
Smooth Muscle Myosin Heavy Chain (SM-MHC) (MYH11/2303R), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC401236-100 1x 100 µL
PTH (Parathyroid Hormone) (N & C Terminal) (3H9 + PTH/1175), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC941010-100 1x 100 µL
Cytochrome C (CYCS/1010), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details