Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IGSF11, Human (HEK293, Fc)

IGSF11 Protein functions as a cell adhesion molecule, facilitating cellular adhesion through homophilic interactions. It also stimulates cell growth, suggesting its role in regulating cellular proliferation. IGSF11 Protein, Human (HEK293, Fc) is the recombinant human-derived IGSF11 protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

IGSF11 Protein, Human (HEK293, Fc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/igsf11-protein-human-hek-293-fc.html

Purity

95.00

Smiles

LEVSESPGSIQVARGQPAVLPCTFTTSAALINLNVIWMVTPLSNANQPEQVILYQGGQMFDGAPRFHGRVGFTGTMPATNVSIFINNTQLSDTGTYQCLVNNLPDIGGRNIGVTGLTVLVPPSAPHCQIQGSQDIGSDVILLCSSEEGIPRPTYLWEKLDNTLKLPPTATQDQVQGTVTIRNISALSSGLYQCVASNAIGTSTCLLDLQVISPQPRNIGLIAG

Molecular Formula

152404 (Gene_ID) Q5DX21-1 (L23-G245) (Accession)

Molecular Weight

57-70 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human KRAS / K-Ras (G12C, Q61H) Protein (His Tag)
PH50581E1-01 100 µg

Human KRAS / K-Ras (G12C, Q61H) Protein (His Tag)

Sign In for Pricing
View Details
Human KRAS / K-Ras (G12C, Q61H) Protein (His Tag)
PH50581E1-02 1 mg

Human KRAS / K-Ras (G12C, Q61H) Protein (His Tag)

Sign In for Pricing
View Details
Leprot siRNA Oligos set (Mouse)
26450174 3x 5 nmol

Leprot siRNA Oligos set (Mouse)

Sign In for Pricing
View Details
TRMT2A Antibody, mAb, Rabbit
A05306-50 50 µL

TRMT2A Antibody, mAb, Rabbit

Sign In for Pricing
View Details
ACRV1 (NM_020110) Human Recombinant Protein
TP313557 20 µg

ACRV1 (NM_020110) Human Recombinant Protein

Sign In for Pricing
View Details
CLP1 Antibody
GWB-MX100A 50 µg

CLP1 Antibody

Sign In for Pricing
View Details