Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Sheep Growth/differentiation factor 9 (GDF9)

Product Specifications

Product Name Alternative

(GDF-9)

Abbreviation

Recombinant Sheep GDF9 protein

Gene Name

GDF9

UniProt

O77681

Expression Region

319-453aa

Organism

Ovis aries (Sheep)

Target Sequence

DQESASSELKKPLVPASVNLSEYFKQFLFPQNECELHDFRLSFSQLKWDNWIVAPHKYNPRYCKGDCPRAVGHRYGSPVHTMVQNIIHEKLDSSVPRPSCVPAKYSPLSVLAIEPDGSIAYKEYEDMIATKCTCR

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Signal Transduction

Relevance

Required for ovarian folliculogenesis.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

22.9 kDa

References & Citations

"The ratio of growth differentiation factor 9: bone morphogenetic protein 15 mRNA expression is tightly co-regulated and differs between species over a wide range of ovulation rates." Crawford J.L., McNatty K.P. Mol. Cell. Endocrinol. 348:339-343 (2012)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Involucrin (SY5), CF740 conjugate, 0.1mg/mL
BNC740678-100 1x 100 µL

Involucrin (SY5), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ROR gamma (RORC) (NM_005060) Human Over-expression Lysate
LY401568 100 µg

ROR gamma (RORC) (NM_005060) Human Over-expression Lysate

Sign In for Pricing
View Details
Human Kappa Light Chain (L1C1), CF647 conjugate, 0.1mg/mL
BNC470018-500 1x 500 µL

Human Kappa Light Chain (L1C1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS800318 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
ETS1 / (Marker of Tumor Metastasis) (ETS1/1282), CF640R conjugate, 0.1mg/mL
BNC401282-100 1x 100 µL

ETS1 / (Marker of Tumor Metastasis) (ETS1/1282), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Icatibant (1-5) Trifluoroacetic Acid Salt
TRC-I163755-5MG 5 mg

Icatibant (1-5) Trifluoroacetic Acid Salt

Sign In for Pricing
View Details