Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Sheep Growth/differentiation factor 9 (GDF9)

Product Specifications

Product Name Alternative

(GDF-9)

Abbreviation

Recombinant Sheep GDF9 protein

Gene Name

GDF9

UniProt

O77681

Expression Region

319-453aa

Organism

Ovis aries (Sheep)

Target Sequence

DQESASSELKKPLVPASVNLSEYFKQFLFPQNECELHDFRLSFSQLKWDNWIVAPHKYNPRYCKGDCPRAVGHRYGSPVHTMVQNIIHEKLDSSVPRPSCVPAKYSPLSVLAIEPDGSIAYKEYEDMIATKCTCR

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Signal Transduction

Relevance

Required for ovarian folliculogenesis.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

22.9 kDa

References & Citations

"The ratio of growth differentiation factor 9: bone morphogenetic protein 15 mRNA expression is tightly co-regulated and differs between species over a wide range of ovulation rates." Crawford J.L., McNatty K.P. Mol. Cell. Endocrinol. 348:339-343 (2012)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Myeloid-Associated Differentiation Marker (MYADM/971), 0.2mg/mL
BNUB0971-100 1x 100 µL

Myeloid-Associated Differentiation Marker (MYADM/971), 0.2mg/mL

Sign In for Pricing
View Details
TRITC Conjugated Calystega sepiem Lectin (Hedge Bindweed Rhizomes) -Calsepa-
R-8011-1 1 mg

TRITC Conjugated Calystega sepiem Lectin (Hedge Bindweed Rhizomes) -Calsepa-

Sign In for Pricing
View Details
Kir7.1 (KCNJ13) (N-term) Rabbit Polyclonal Antibody
AP52310PU-N 400 µL

Kir7.1 (KCNJ13) (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ETFB (NM_001985) Human Over-expression Lysate
LC419607 20 µg

ETFB (NM_001985) Human Over-expression Lysate

Sign In for Pricing
View Details
TAF6L Antibody
8C11986-AAT 50 µg

TAF6L Antibody

Sign In for Pricing
View Details
GNPTG (NM_032520) Human Over-expression Lysate
LY403165 100 µg

GNPTG (NM_032520) Human Over-expression Lysate

Sign In for Pricing
View Details