Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Sheep Growth/differentiation factor 9 (GDF9)

Product Specifications

Product Name Alternative

(GDF-9)

Abbreviation

Recombinant Sheep GDF9 protein

Gene Name

GDF9

UniProt

O77681

Expression Region

319-453aa

Organism

Ovis aries (Sheep)

Target Sequence

DQESASSELKKPLVPASVNLSEYFKQFLFPQNECELHDFRLSFSQLKWDNWIVAPHKYNPRYCKGDCPRAVGHRYGSPVHTMVQNIIHEKLDSSVPRPSCVPAKYSPLSVLAIEPDGSIAYKEYEDMIATKCTCR

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Signal Transduction

Relevance

Required for ovarian folliculogenesis.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

22.9 kDa

References & Citations

"The ratio of growth differentiation factor 9: bone morphogenetic protein 15 mRNA expression is tightly co-regulated and differs between species over a wide range of ovulation rates." Crawford J.L., McNatty K.P. Mol. Cell. Endocrinol. 348:339-343 (2012)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ACE (ACE1, DCP, DCP1, Angiotensin-converting enzyme, Dipeptidyl carboxypeptidase I, Kininase II, CD antigen CD143)
304292-01 50 µg

ACE (ACE1, DCP, DCP1, Angiotensin-converting enzyme, Dipeptidyl carboxypeptidase I, Kininase II, CD antigen CD143)

Sign In for Pricing
View Details
ACE (ACE1, DCP, DCP1, Angiotensin-converting enzyme, Dipeptidyl carboxypeptidase I, Kininase II, CD antigen CD143)
304292-02 100 µg

ACE (ACE1, DCP, DCP1, Angiotensin-converting enzyme, Dipeptidyl carboxypeptidase I, Kininase II, CD antigen CD143)

Sign In for Pricing
View Details
Rat Type I Collagen-Lyophilized
MBS674530-01 0.25 mg

Rat Type I Collagen-Lyophilized

Sign In for Pricing
View Details
Rat Type I Collagen-Lyophilized
MBS674530-02 5x 0.25 mg

Rat Type I Collagen-Lyophilized

Sign In for Pricing
View Details
PLA2G2A Rabbit Polyclonal Antibody (APC-Cy5.5)
orb2460252 100 µL

PLA2G2A Rabbit Polyclonal Antibody (APC-Cy5.5)

Sign In for Pricing
View Details
MARCKS Knockout HEK293T Polyclonal Cells
ARG3250 1 Million

MARCKS Knockout HEK293T Polyclonal Cells

Sign In for Pricing
View Details