Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human C-C motif chemokine 1 (CCL1), Biotinylated

Product Specifications

Product Name Alternative

(Small-inducible cytokine A1) (T lymphocyte-secreted protein I-309)

Abbreviation

Recombinant Human CCL1 protein, Biotinylated

Gene Name

CCL1

UniProt

P22362

Expression Region

24-96aa

Organism

Homo sapiens (Human)

Target Sequence

KSMQVPFSRCCFSFAEQEIPLRAILCYRNTSSICSNEGLIFKLKRGKEACALDTVGWVQRHRKMLRHCPSKRK

Tag

N-terminal MBP-tagged and C-terminal 6xHis-Avi-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Immunology

Relevance

Cytokine that is chemotactic for monocytes but not for neutrophils. Binds to CCR8.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

56.3 kDa

References & Citations

"The human cytokine I-309 is a monocyte chemoattractant." Miller M.D., Krangel M.S. Proc. Natl. Acad. Sci. U.S.A. 89:2950-2954 (1992)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human SLC22A1/Solute Carrier Family 22 Member 1 ELISA Kit
MBS2890636-01 48 Well

Human SLC22A1/Solute Carrier Family 22 Member 1 ELISA Kit

Sign In for Pricing
View Details
Human SLC22A1/Solute Carrier Family 22 Member 1 ELISA Kit
MBS2890636-02 96 Well

Human SLC22A1/Solute Carrier Family 22 Member 1 ELISA Kit

Sign In for Pricing
View Details
Human SLC22A1/Solute Carrier Family 22 Member 1 ELISA Kit
MBS2890636-03 5x 96 Well

Human SLC22A1/Solute Carrier Family 22 Member 1 ELISA Kit

Sign In for Pricing
View Details
Human SLC22A1/Solute Carrier Family 22 Member 1 ELISA Kit
MBS2890636-04 10x 96 Well

Human SLC22A1/Solute Carrier Family 22 Member 1 ELISA Kit

Sign In for Pricing
View Details
Mbd1 3'UTR GFP Stable Cell Line
TU162952 1.0 mL

Mbd1 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
M8-B (hydrochloride) 2mg
A22607-2 2 mg

M8-B (hydrochloride) 2mg

Sign In for Pricing
View Details