Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRIM24, Human (P. pastoris, His)

TRIM24 protein is a multifunctional coactivator that dynamically interacts with nuclear receptors and coactivators to influence target gene transcription. It binds preferentially to unmodified H3K4me0 and acetylated H3K23. TRIM24 Protein, Human (P. pastoris, His) is the recombinant human-derived TRIM24 protein, expressed by P. pastoris , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

TRIM24 Protein, Human (P. pastoris, His), Human, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/trim24-protein-human-p-pastoris-his.html

Smiles

KKKTEGLVKLTPIDKRKCERLLLFLYCHEMSLAFQDPVPLTVPDYYKIIKNPMDLSTIKKRLQEDYSMYSKPEDFVADFRLIFQNCAEFNEPDSEVANAGIKLENYFEELLKNLYPEKRFPK

Molecular Formula

8805 (Gene_ID) O15164 (K891-K1012) (Accession)

Molecular Weight

16.5 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

P53 (PAb122), CF740 conjugate, 0.1mg/mL
BNC740338-100 1x 100 µL

P53 (PAb122), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (DF1485), CF640R conjugate, 0.1mg/mL
BNC401037-100 1x 100 µL

CD44 Standard (DF1485), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FOXP3 (3G3), CF594 conjugate, 0.1mg/mL
BNC940645-500 1x 500 µL

FOXP3 (3G3), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD28 (204.12), CF647 conjugate, 0.1mg/mL
BNC470164-500 1x 500 µL

CD28 (204.12), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TAG-72 / CA72.4 (B72.3), Biotin conjugate, 0.1mg/mL
BNCB0276-100 1x 100 µL

TAG-72 / CA72.4 (B72.3), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD56 / NCAM1 / NKH1 (Neuronal Cell Marker) (NCAM1/2217R), CF640R conjugate, 0.1mg/mL
BNC402217-100 1x 100 µL

CD56 / NCAM1 / NKH1 (Neuronal Cell Marker) (NCAM1/2217R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details