Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

COPZ1, Human/Mouse/Rat (His)

The COPZ1 protein is a key coating subunit essential for intracellular protein transport.In coat isoform complexes, it binds to a dilysine motif that facilitates reversible association with Golgi vesicles.COPZ1 Protein, Human/Mouse/Rat (His) is the recombinant COPZ1 protein, expressed by E.coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

COPZ1 Protein, Human/Mouse/Rat (His), Rat; Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/copz1-protein-rat-his.html

Purity

98.00

Smiles

MEALILEPSLYTVKAILILDNDGDRLFAKYYDDTYPSVKEQKAFEKNIFNKTHRTDSEIALLEGLTVVYKSSIDLYFYVIGSSYENELMLMAVLNCLFDSLSQMLRKNVEKRALLENMEGLFLAVDEIVDGGVILESDPQQVVHRVALRGEDVPLTEQTVSQVLQSAKEQIKWSLLR

Molecular Formula

22818 (Gene_ID) P61923/NP_001101587.1 (M1-R177) (Accession)

Molecular Weight

Approximately 22.4 kDa.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

PTEN, Phosphorylated (S385) (PTEN, MMAC1, TEP1, Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN, Mutated in multiple advanced cancers 1, Phosphatase and tensin homolog) (MaxLight 650)
MBS6338554-01 0.1 mL

PTEN, Phosphorylated (S385) (PTEN, MMAC1, TEP1, Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN, Mutated in multiple advanced cancers 1, Phosphatase and tensin homolog) (MaxLight 650)

Ask
View Details
PTEN, Phosphorylated (S385) (PTEN, MMAC1, TEP1, Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN, Mutated in multiple advanced cancers 1, Phosphatase and tensin homolog) (MaxLight 650)
MBS6338554-02 5x 0.1 mL

PTEN, Phosphorylated (S385) (PTEN, MMAC1, TEP1, Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN, Mutated in multiple advanced cancers 1, Phosphatase and tensin homolog) (MaxLight 650)

Ask
View Details
Mouse Syntaxin-4, Stx4 ELISA KIT
ELI-29904m 96 Tests

Mouse Syntaxin-4, Stx4 ELISA KIT

Ask
View Details
Microtubule Associated Protein 1 Light Chain 3 Gamma (MAP1LC3C) Antibody
abx302325-01 20 µg

Microtubule Associated Protein 1 Light Chain 3 Gamma (MAP1LC3C) Antibody

Ask
View Details
Microtubule Associated Protein 1 Light Chain 3 Gamma (MAP1LC3C) Antibody
abx302325-02 50 µg

Microtubule Associated Protein 1 Light Chain 3 Gamma (MAP1LC3C) Antibody

Ask
View Details
Microtubule Associated Protein 1 Light Chain 3 Gamma (MAP1LC3C) Antibody
abx302325-03 100 µg

Microtubule Associated Protein 1 Light Chain 3 Gamma (MAP1LC3C) Antibody

Ask
View Details