COPZ1, Human/Mouse/Rat (His)
The COPZ1 protein is a key coating subunit essential for intracellular protein transport.In coat isoform complexes, it binds to a dilysine motif that facilitates reversible association with Golgi vesicles.COPZ1 Protein, Human/Mouse/Rat (His) is the recombinant COPZ1 protein, expressed by E.coli , with N-His labeled tag.
Product Specifications
Product Name Alternative
COPZ1 Protein, Human/Mouse/Rat (His), Rat; Mouse, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/copz1-protein-rat-his.html
Purity
98.00
Smiles
MEALILEPSLYTVKAILILDNDGDRLFAKYYDDTYPSVKEQKAFEKNIFNKTHRTDSEIALLEGLTVVYKSSIDLYFYVIGSSYENELMLMAVLNCLFDSLSQMLRKNVEKRALLENMEGLFLAVDEIVDGGVILESDPQQVVHRVALRGEDVPLTEQTVSQVLQSAKEQIKWSLLR
Molecular Formula
22818 (Gene_ID) P61923/NP_001101587.1 (M1-R177) (Accession)
Molecular Weight
Approximately 22.4 kDa.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC880352-500 1x 500 µL
CD31 / PECAM-1 (158-2B3), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC401073-500 1x 500 µL
HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400668-100 1x 100 µL
MART-1 / Melan-A (A103), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC041799-100 1x 100 µL
P53 Tumor Suppressor Protein (TP53/1799R), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC881171-100 1x 100 µL
CD34 (HPCA1/1171), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740371-500 1x 500 µL
Cytokeratin, pan (AE-1 / AE-3), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details