Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Interleukin-3 (IL3)

Product Specifications

Product Name Alternative

IL-3; Hematopoietic growth factor; Mast cell growth factor; MCGF; Multipotential colony-stimulating factor; P-cell-stimulating factor

Abbreviation

Recombinant Bovine IL3 protein

Gene Name

IL3

UniProt

P49875

Expression Region

18-144aa

Organism

Bos taurus (Bovine)

Target Sequence

APQAKGLPVVTSRTPYSMLMKEIMDDLKKITPSPEGSLNSDEKNFLTKESLLQANLKVFMTFATDTFGSDSKIMKNLKEFQPVLPTATPTEDPIFIENKNLGDFRMKLEEYLVIIRNYLKSKNIWFS

Tag

C-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Immunology

Relevance

Granulocyte/macrophage colony-stimulating factors are cytokines that act in hematopoiesis by controlling the production, differentiation, and function of 2 related white cell populations of the blood, the granulocytes and the monocytes-macrophages. ; This CSF induces granulocytes, macrophages, mast cells, stem cells, erythroid cells, eosinophils and megakaryocytes.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

21.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cadherin 17 / LI Cadherin (Liver-Intestine Marker) (CDH17/2615), CF568 conjugate, 0.1mg/mL
BNC682615-100 1x 100 µL

Cadherin 17 / LI Cadherin (Liver-Intestine Marker) (CDH17/2615), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PEX5 (NM_001131024) Human Over-expression Lysate
LC427362 20 µg

PEX5 (NM_001131024) Human Over-expression Lysate

Sign In for Pricing
View Details
CFTR Human Gene Knockout Kit (CRISPR)
KN216476BN 1 Kit

CFTR Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human C4 (Complement Component 4) ELISA Kit
E-EL-H6309-01 24 Tests

Human C4 (Complement Component 4) ELISA Kit

Sign In for Pricing
View Details
Human C4 (Complement Component 4) ELISA Kit
E-EL-H6309-02 48 Tests

Human C4 (Complement Component 4) ELISA Kit

Sign In for Pricing
View Details
Human C4 (Complement Component 4) ELISA Kit
E-EL-H6309-03 96 Tests

Human C4 (Complement Component 4) ELISA Kit

Sign In for Pricing
View Details